SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001039 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001039
Domain Number 1 Region: 74-338
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.29e-51
Family Ankyrin repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 411-458
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000119
Family SOCS box-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001039   Gene: ENSONIG00000000816   Transcript: ENSONIT00000001038
Sequence length 464
Comment pep:known_by_projection scaffold:Orenil1.0:GL831149.1:560981:565262:-1 gene:ENSONIG00000000816 transcript:ENSONIT00000001038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKDTFPFTSTSLRSLRLEQAFQEWEDARRALAHRRAMTRAPLPRAPRPPPRQQRLQEVR
APPPQVRCRDAAVHNTFMCGDMKGVYAVLKDPAMVNALMETVHEEMVWAPEMGMWTMSST
VKQTSALRLAASRGHTACVEELLFRGAEVNADPGGNTALHDACIGGHSICVQLLLSHGAE
PDLLAADGSAPLHLCTSAQSFHCAELLLEGGAEVNVRTNESRLTPLHVAARRGLEEHVEL
FLSHGADVLATNREGETPLNAACSGAERPSEAGRYLRVIQKLLDAGASARTAGRKQHTPL
HNACANCCPRIVDLLLQHGAKADVTNCAGYTAMDCLLQVVEDFPDQQPEAIARSLLNHGA
KPVSPKMLKQCVLSPATVEVLLNSYPHLPPCEWMDAVSAEIYEDHRSFFQLVRQRSAQPR
SLQHLCRCALRQHLGAQCHSVVSKLDIPSCVRDYLLLCNDGTLF
Download sequence
Identical sequences I3IWP9
ENSONIP00000001039 ENSONIP00000001039 XP_005468982.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]