SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001154 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001154
Domain Number 1 Region: 113-438
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.75e-83
Family G proteins 0.00000179
Further Details:      
 
Domain Number 2 Region: 659-827
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.04e-58
Family Translational machinery components 0.0000196
Further Details:      
 
Domain Number 3 Region: 442-567
Classification Level Classification E-value
Superfamily Translation proteins 1.87e-33
Family Elongation factors 0.00042
Further Details:      
 
Domain Number 4 Region: 828-914
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.06e-26
Family EF-G/eEF-2 domains III and V 0.00025
Further Details:      
 
Domain Number 5 Region: 584-657
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.69e-17
Family EF-G/eEF-2 domains III and V 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001154   Gene: ENSONIG00000000912   Transcript: ENSONIT00000001153
Sequence length 971
Comment pep:known_by_projection scaffold:Orenil1.0:GL831149.1:1607031:1620599:-1 gene:ENSONIG00000000912 transcript:ENSONIT00000001153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEADLYDEFGNYIGPELDSDDDDDDLDAEDRDVDEGDEDDEDEPADADDDVPGMEVVLHE
DKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKNKQFTLMEQELPATVYDMEFLAD
LMDGPELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRDDVDLRYTDILFTEQERGVGI
KSTPVTMVLPDSRGKSYLFNIMDTPGHVNFSDEVTSSIRLSDGVVLFIDAAEGVMLNTER
LIKHAVQERMAITICINKVDRLILELKLPPTDAYYKLRHIVDEVNGLLSTYSTDENLVVS
PLLGNVCFASSQYSICFTLGSFAKIYSDTYGDINYNEFAKRLWGDIYFNPKTRKFTKKAP
SSNSQRSFVEFVLEPLYKILSQVVGDVDTSLPRVLDELGIHLTKEELKLNIRPLLRLVCN
RFFGEFTGFVDMCVQHIPSPQEGARNKIEHTYTGGLDSDLGEVMAECDPDGPLMCHTTKM
YSTEDGVQFHAFGRVLSGTIQAGQPVKVLGENYTLEDEEDSQVCTVGRLWISVARYQIEV
NRVPAGNWVLIEGCDQPIVKTATITEPRGNEEAQIFRPLKFNTASVIKIAVEPVNPSELP
KMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVVT
FCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQISWNRKKLGEFFQTK
YDWDLLAARSIWAFGPDTTGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCD
EPIRNVKFKILDAVIAQEPLHRGGGQVIPTARRVVYSAFLMATPRLMEPYYFVEVQAPAD
CVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFALSVF
HHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLEL
AKQDVVLNYPM
Download sequence
Identical sequences I3IX14
ENSONIP00000001154 XP_003442062.1.78416 XP_004552404.1.88231 ENSONIP00000001154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]