SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001314 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001314
Domain Number 1 Region: 172-547
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.54e-68
Family WD40-repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 1304-1428
Classification Level Classification E-value
Superfamily Bromodomain 4.06e-31
Family Bromodomain 0.00023
Further Details:      
 
Domain Number 3 Region: 1149-1260
Classification Level Classification E-value
Superfamily Bromodomain 1.83e-22
Family Bromodomain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001314   Gene: ENSONIG00000001037   Transcript: ENSONIT00000001313
Sequence length 1845
Comment pep:known_by_projection scaffold:Orenil1.0:GL831143.1:4969361:5002687:1 gene:ENSONIG00000001037 transcript:ENSONIT00000001313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDSTHIAQLTSELYFLIARFLEAGPCQKAAETLIREVEEKELLPRRLDWTGQEHPGTY
ENLVKLYRHITPDHLLQVCTRVCPLLEREVPASVPGLTSLLGAGRQNLLRTAKSCKHVVW
KGSALAALHCGRPPEPPVIYGSPPNIVETSFCRRLNGAYRLRQLVPTAVYTHMKMHKRIL
GHLSSVYCVTFDRTGRRIFTGSDDCLVKIWGTDDGRLLATLRGHAAEISDMAVSYENTMI
AAGSCDKTIRVWCLQTCAPLAVLEGHAASITSLQFSPLCSGSKRYLSSTGADGTICFWQW
DARTLKFGKPNSANMSKCSRPGVQMICSSFSAGGMFLATGSTDHIIRVYYFGSGQPEKIS
ELESHTDKVDSIQFSHCSDRWFVSGSRDGTARIWQLHPQGWKSILLDMQTKLPGKYNPPP
LEDKVTKLKVTMVAWDRHDSTVITAANNLTLKVWNSITGNLVHVLMGHEDEVFVLEPHPF
DPRILFSAGHDGNCIVWDLARGVKIRSYFNMIEGQGHGALFDCKCSPDGQHFAATDSHGH
LLIFGFGSSSKYDKIADQMFFHTDYRPLIRDANNYVLDEQTQQAPHLMPPPFLVDVDGNP
HPPRYQRLVPGREGCRDEQLIPQMGVTSSGLNQVVSEQAVDGPSPLDTMIQRLQQEQDQR
LGTNDVSAAAANTRSSRGSVGSPTEVHSPPNVGLRRSGQIEGVRQMHSNAPRSQMATEGD
LVAWSRRVLVPELEEASVRRQVNWREAKGEEEINIYQSERRRRTLHSLPKESRVHPTSEC
VVDEARRSQGNHGYQTRAAMEETSRQSAEAADEDDSTSEGEVEVRQINGHSSEEEKDDEE
KEPWPDEHSSSSDYSSDYSDWTADAGINLEPPKKSVKVKKKSSGSEEDGEKKREGKKERK
KDKADKDGALPKKKKPKEKRKRTQFQEQGLTLEEWLPSAWITDTVPRRCPYIPQMGDEVY
YFRQGHEAYVEMAKQKKIYSINPKKQPWHKMELREQELMKIVGIKYEVGLPTLCCLKLAF
LDPDTGKLTGGSFSMKYHDMPDVIDFLVLRQQFDNARKRQWRIGDRFRSVIDDAWWFGTI
ESQEPYQSQYPDSLFQCYNVCWDNGDTEKMSPWDMEPIPDDATFPDELGQSVPLIEEEQK
ELLYVPLDGEWGCRTRAEECERIIKAIDQLCTLANTDVAAPFAFPVDLQAYPTYCTVVAY
VTDLSTIRQRLVNRFYRRLSSLMWEVRYIEHNAQTFNEPGSFIVTTAKFVSDLMLQFIKD
QSLTDIMPLHKTMKKATFSDSEDEDDEEEDEDTNTPGTSTRNHKGRRPIQRQLRARPHSY
DPHAWKGRCKELLDLIFQCEDSEPFREPVDLQEYPDYLQIVESPMDFGTVLNTLTEGKYQ
SPIELCKDVRLIFSNSKAYTPSKKSRIYSMSLRLSALFEEHISPILADYKAIHGLTDRQT
RHVMKRRRRRSESPASSTASSPERKRRVSSRVNAKKEPSPVPSRPSSLRQSIPVKQQPPQ
MVNGKAETPAPGRTRSAARHTTHSLPSSSSSHNVMNSTPSTTGIITVTESTRSLRAHNSV
PASSSPAPEKVTPSQSTESSSGSTRRKLRTPVRHTPGRKHLRFCSFSFSLSGSPGSTSSH
STVHLNGHSSHVTLGVGRRGRKSRLEPPVSPPEVSTPASPSRPRGRPPGKKRGRKSKQEA
EDIRQSGSRRSFTPDDEVDPSTGDEGGMSSAQEVLSDSGMASTPRRRGRPRVVRIEEPAP
PPESPEPSPLRRSSRRANEEGTPPLQTQRPSRKEPPKEEEEAGDEAGGSMRTRNQGRRSA
WYMEEDSEEEQRQLLFEDSSITFGTSSKGRVRKLTEKAKANLIGW
Download sequence
Identical sequences I3IXH4
ENSONIP00000001314 ENSONIP00000001314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]