SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001444 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001444
Domain Number 1 Region: 56-293
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.28e-48
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 295-334
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000471
Family SOCS box-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001444   Gene: ENSONIG00000001140   Transcript: ENSONIT00000001443
Sequence length 335
Comment pep:known_by_projection scaffold:Orenil1.0:GL831156.1:1868934:1875204:-1 gene:ENSONIG00000001140 transcript:ENSONIT00000001443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDHTEEFTNKPFAAQLSNVYLSILALFCFKLFVKISLNLLTYFYIVRGNRKEAARISAE
FYDYGQQHRSWADRSPLHDAASQGRLLALRTLILQGHNVNVLTIDHVTPLHEACLGDHVA
CARALIDAGANVNASTIDGVTALFNACTVGSVACTEILLENGAKPQSLLYQPSPIHEATS
KGHYGCVEALVTWGADVDMDIPHLGTALYTACVCQELECARKLLSLLHVGANVQKGKSLD
SPLHAAAEKDCTAVVKLLLDFGADINARNTEFQRPVDVAPPSSLTEGFLLLYEATPRLLS
QLCRQCIRNCVGRDRLHLLSHLPLPNRIKSYLQYQ
Download sequence
Identical sequences I3IXV4
ENSONIP00000001444 ENSONIP00000001444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]