SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001452 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001452
Domain Number 1 Region: 38-67,184-353
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.29e-58
Family G proteins 0.0000000183
Further Details:      
 
Domain Number 2 Region: 67-186
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 5.63e-41
Family Transducin (alpha subunit), insertion domain 0.00000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001452   Gene: ENSONIG00000001147   Transcript: ENSONIT00000001451
Sequence length 359
Comment pep:known_by_projection scaffold:Orenil1.0:GL831153.1:3630419:3648913:-1 gene:ENSONIG00000001147 transcript:ENSONIT00000001451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLESMMACCLSEEAKESKRINAEIDKQLRRDKRDSRRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSDEDKRGFIRLVYQNIFTSMQSMIRATENLKIPYKYEDNRANAMLVKEVDIEK
INSFEQPYITAIKSLWADPGIQEAYDRRREYQLSDSTKYYLSDLDRISDPNYLPTQQDVL
RVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKITYSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
Download sequence
Identical sequences I3IXW2
ENSONIP00000001452 XP_003442957.1.78416 ENSONIP00000001452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]