SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001471 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001471
Domain Number 1 Region: 180-434
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.45e-69
Family Extended AAA-ATPase domain 0.00000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001471   Gene: ENSONIG00000001163   Transcript: ENSONIT00000001470
Sequence length 440
Comment pep:known_by_projection scaffold:Orenil1.0:GL831143.1:6304968:6314249:1 gene:ENSONIG00000001163 transcript:ENSONIT00000001470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQSQSGGHGPGGGKKDDKDKKKKYEPPIPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL
KLLKQERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAP
QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSG
GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT
KRRIFQIHTSRMTVADDVTLDDLILAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK
KSKENVLYKKQEGTPEGLYL
Download sequence
Identical sequences A0A087Y153 I3IXY1
ENSONIP00000001471 XP_003440735.1.78416 XP_003971504.1.43653 XP_004542305.1.88231 XP_005917148.1.24487 XP_007568997.1.10163 XP_008282305.1.38333 XP_008396443.1.1237 XP_010755249.1.61708 XP_013764200.1.53837 XP_014824756.1.96476 XP_014872531.1.100837 XP_018550287.1.34915 XP_018550288.1.34915 XP_020783421.1.12261 XP_022065915.1.10920 ENSONIP00000001471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]