SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001595 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001595
Domain Number 1 Region: 22-326
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.09e-79
Family G proteins 0.00000018
Further Details:      
 
Domain Number 2 Region: 304-385
Classification Level Classification E-value
Superfamily TGS-like 4.14e-35
Family G domain-linked domain 0.0000696
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001595   Gene: ENSONIG00000001265   Transcript: ENSONIT00000001594
Sequence length 395
Comment pep:known_by_projection scaffold:Orenil1.0:GL831153.1:4380962:4385747:-1 gene:ENSONIG00000001265 transcript:ENSONIT00000001594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKTEAPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTIDPNE
SRVPVPDERFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHSGQGLGNAFLSNISACDGIF
HMTRAFDDEDIIHVEGNVDPVRDIEIIHEELRLKDEEMIGPIIDKLEKTAVRGSDKKLKP
EYDIMLKIKNWVVEEKKHIRFYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRKKN
KWLAKIKEWVDAHDPGAMVIPLSGALEFKLQDMEEEERNKYCEEQKTQSVLTKIIKTGYA
ALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFTDFKEEGSETA
AKAAGKYRQQGRNYIVEDGDIIFFKFNTPNAPKKK
Download sequence
Identical sequences I3IYA5
ENSONIP00000001595 XP_003442972.1.78416 XP_004540365.1.88231 ENSONIP00000001595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]