SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000001635 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000001635
Domain Number 1 Region: 151-352,399-510
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-39
Family Extended AAA-ATPase domain 0.011
Further Details:      
 
Domain Number 2 Region: 20-108
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.45e-27
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000001635   Gene: ENSONIG00000001295   Transcript: ENSONIT00000001634
Sequence length 658
Comment pep:known_by_projection scaffold:Orenil1.0:GL831143.1:7802374:7808030:-1 gene:ENSONIG00000001295 transcript:ENSONIT00000001634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKYTDLTSLDAFPSSAIYPTKDEENNPLETEFGLSIYKDHQTITVQEMPEKAPAGQLP
RSVDIILDNDLVDAVKPGDRVQVVGTYRCLPGKKGGFTSGTFRTIMIACHIKQMSKEVSP
CFTADDVAKIRNFSRTRSKDVFDQLARSLAPSIHGHEYIKKAILCMLLGGVEKVLENGSR
IRGDINILLIGDPSVAKSQLLRYVLHTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLE
AGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANP
VYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDHVLRMHRYRDPREQE
GAAMALGGTVDVLATEDPDAAVEEHEELQIYEKHNNLLHGSKRKRDKIVSKEFMRKYIHI
AKAVTPVLTEEAANHIAEEYSRLRSQEQLGADLARTSPVTARTLETLIRLSTAHAKARMS
KAVELQDSEVAVELVQFAYFKKVLEKEKKRSRQERDSDSEEEEEMPTQRSQRAVRKRGRR
GSQGSEPYSPYDFSEDQEVPEIQAGTPKPAKPREDEPMDASLQAEDAELSAERLKEFKSS
LFAVFQSAHAQSVKMSALMDDINKERQNTFAEAEVRAALARMQDDNQVMVADDIIFLI
Download sequence
Identical sequences I3IYE5
ENSONIP00000001635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]