SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002005 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002005
Domain Number 1 Region: 958-1161
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.9e-57
Family ABC transporter ATPase domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 1980-2214
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.88e-49
Family ABC transporter ATPase domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002005   Gene: ENSONIG00000001599   Transcript: ENSONIT00000002004
Sequence length 2337
Comment pep:known_by_projection scaffold:Orenil1.0:GL831156.1:5579390:5619099:-1 gene:ENSONIG00000001599 transcript:ENSONIT00000002004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSEGRGGDRESRTEQLTASHTERAAADDHSGGAATAAAGMSVTTQLGLLLWKNFTYRR
RQTLQLLAEIVWPLLIFFILISVRLNYPPYEQHECHFPNKAMPSAGTLPWLQGILCNANN
PCFRHPTPGESPGIVGNFNDSIISRLFSDAKKILLYSQNDKNLEGFKELARALQVLQSSR
SGFKLKHFLRDNETLSSFLLRNASFPEHSVQQITEAGINLEKVLLGGFGVHLRDMCPSKG
GKQSLEEFVTISDLQVSAMVQEKICQTSPTWLNHAEEHFLDNVDFLKPIRRDVRADPEAV
QQVARATDNLLDSLGSLAVELASMKSWIDLRNEIVFLTQNATSSPSTMYQAVSRIVCGHP
EGGGLQIKSLNWYEDSNYKALFGNYNSSEDETASLYDNSSTPYCNSLVKNMDSNPMSRMI
WQALKPLLLGKILYTPHTPATQKIIHEVNRTFQELGVFRELGGMWEEIRPKVWDFMENSE
QMNVIRTLLKNNITARVFRAQLADTDWTVEDISNFLSKQADDQQPPGSTLTWRDVFNETD
QAIMSISHFMECVNLDKLEPVSNEERMVNLSMKLLEDRKFWAGIVFLDVPSNATELPPKL
NYKIRMDIDNVERTNKIKDAYWDPGPRADPFEDMRYIWGGFSYLQDVIEQGIIRAMTGTK
EKTGVYIQQMPYPCYVDDIFLRVMSRSMPLFMTLAWMYSVAIILKSVVYEKEARLKETMR
IMGLDNGILWFSWFISSLIPLLISAGLLVLLLKMGNLLPYSDPGVIFLFLGSFGVVTIMQ
CFLLSTAFARANLAAACGGIIYFTLYLPYVLCVAWEEYIGFGTKVFASLLSPVAFGFGCE
YFALFEEQGVGIQWKNLVSSPLEEDDFSLRTAIIIMYFDSFLYGVLTWYLEAVFPGQYGI
PRPWYFPFTKSYWFGEKDGKSTKLPLNRKGNPGAVCMEEEPTHLEPGVYIENLVKVYRHG
KKLAVDGLTLGFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILGRDIRTELSAI
RQSLGVCPQHNVLFSMLTVEEHIWFYARLKGLPEERVKGEIEQILQDTGLPHKRNCRTST
LSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRQGRTIILSTHHMD
EADILGDRIAIISHGKLCCVGSSLYLKNQLGTGYYLTLVKKNQEPSLSSCRNSASTVSFT
KKEEECGSVSSSDAGLGSEHESEAATIENGPAASICNIPFVPPDVSLVSALILRHVPDAR
LVEDLGHELTYVLPYSAAKDGAFVELFKDLDTKLSDLGISSYGVSDTTLEEIFLKVAEDN
GVDTEVTSDGTFPVQRRRRTHAFGGGDPQSCLRPLTDDDNDDCNDSEDQECKETDWLNCT
DGKGSYQVTGWTLRRQQFVALMWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPF
GVYPSLELQPWMYQEQVTFISDDAPGDANMQKLLDALLNVPGFGTRCMDGYTIPEAPCTM
GDEDWYTPEVPESVLELFSSRNWTMDDPSPACMCSCDGKKKMLPDCPAGAGGLPPPEMNL
SDTDILQNLTGRNISDYLVKTYAQIIGKSLKNKVWVNEFRYGGFSLGARSTQVLPPANEI
DDAIERVRKIFELQKGAAADRFLDTLSGFINGLDTKNNVKIWFNNKGWHSIGAFINVMNN
AILRANLPQGRDASKYGISAFNHPLNLTKEQLSQVALVTTSVDVLVSICVIFAMSFVPAS
FVVFLIQERVSKAKHMHFISGVHPLLYWTANFIWDMCNYVVPATLVILIFICFQQKAYVS
STNLPTLALLLLLYGWSITPLMYPASFFFKIPSTAYVVLTSVNILIGINGSISTFVMELF
GNNEIGGINDILKNVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFRSPLEWDMVGK
NLLAMAVEGVVFFFITVLIQYRFCIKPKPVSKLTKLAPLGEEDEDVARERQRIVHGLGQG
DILELRQLTKVFKRKEKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGDTIVTRGE
AFLAGKSILREIDEVHRNMGYCPQFDAINELLTGREHLELYAILRGVPEKEVCDVAEWGI
RKLSLVKYADKAAGSYSGGNMRKLSTSMALIGAPPVVFLDEPTTGMDPKARRALWNCIHS
VIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIILRVAGPN
PDLLPVMKFIESELSGSTLKEKHRNMLQYQLPSSLTSLAHIFSILAKNKETLRIEDYSVT
QTTLDQVFVNFAKDQSDDYHSKDNSVRRKDVVVINLPALSSTSGASHDGGGVSESVM
Download sequence
Identical sequences I3IZG5
ENSONIP00000002005 ENSONIP00000002005 XP_005467245.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]