SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002131 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002131
Domain Number 1 Region: 59-568
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.05e-204
Family Motor proteins 0.000000000000218
Further Details:      
 
Domain Number 2 Region: 576-698
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000000000366
Family Myosin rod fragments 0.005
Further Details:      
 
Domain Number 3 Region: 749-950
Classification Level Classification E-value
Superfamily Tropomyosin 0.000019
Family Tropomyosin 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000002131
Domain Number - Region: 885-1073
Classification Level Classification E-value
Superfamily Tropomyosin 0.000203
Family Tropomyosin 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002131   Gene: ENSONIG00000001702   Transcript: ENSONIT00000002131
Sequence length 1081
Comment pep:known_by_projection scaffold:Orenil1.0:GL831149.1:5363875:5374552:1 gene:ENSONIG00000001702 transcript:ENSONIT00000002131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTDAEMEQYGPAAIYLRKPERERIEAQTAPFDAKTAYFVAVPDEMYVKGKLVKKEGGKA
TVDTLGGKTVTVKEDDIHPMNPPKFDKIEDMAMMTHLNEPAVLFNLKERFASWMIYTYSG
LFCVVVNPYKWLPVYDAQVVVAYRGKKRVEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFAIIAMTASKKAEPTPGKMQGSLEDQIIAANPLLEAYGNAKTVRN
DNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLSAERSYHIFYQLMTGHKPELL
EALLITTNPFDYPMISQGEVTVKSINDVEEFIATDTAIDILGFTAEEKVGIYKLTGAVMH
HGNMKFKQKQREEQAEPDGTEVADKIAYLLGLNSADMLKALCYPRVKVGNEMVTKGQTVP
QVNNAVSALCKSIYEKMFLWMVVRINEMLDTKQPRQFFIGVLDIAGFEIFDFNSLEQLCI
NFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEEC
MFPKASDTTFKNKLHDQHLGKTKTKQRLQGEVEDLMIDVERANALAANLDKKQRNFDKVL
AEWKQKYEESQAELEGAQKEARSLSTELFKMKNSYEEALDHLETIKRENKNLQQEISDLT
EQIGETGKTIHELEKAKKTVETEKSEIQTALEEAEGTLEHEEAKILRIQLELNQVKGEID
RKLAEKDEEMEQIKRNSQRVIDSMQSTLDAEVRSRNDALRIKKKMEGDLNEMEIQLSHAN
RQAAEAQKQLRNVQGQLKDAQLHLDDALRGQEDMKEQVAMVERRNGLMVAEIEELRVALE
QTERGRKVAEQELVDASERVGLLHSQNTSLLNTKKKLEADFVQVQGEVDDAVQEARNAEE
KAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEVTVKDLQHRLDEAESLAMKGGKKQLQ
KLESRVRELEAEVEAEQRRGADAVKGVRKYERRVKELTYQTEEDKKNLVRLQDLVDKLQL
KVKAYKRQAEDAEEQANTHMSRLRKLQHEMEEAQERADIAESQVNKLRAKSRDIGKAEKA
E
Download sequence
Identical sequences I3IZU1
ENSONIP00000002131 ENSONIP00000002131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]