SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002175 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002175
Domain Number 1 Region: 3-412
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.15e-153
Family Motor proteins 0.00000000000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002175   Gene: ENSONIG00000001736   Transcript: ENSONIT00000002175
Sequence length 412
Comment pep:novel scaffold:Orenil1.0:GL831149.1:5427712:5430755:1 gene:ENSONIG00000001736 transcript:ENSONIT00000002175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVETEGGQTVTVKEDDIHPRNPPKFDKMEDMAMMTHLNEPAVLFNLKERYASWMIYTYSG
LFCVVVNPYKWLPVYDATCVAAYRGKKRIEAPPHIFSISDNAYQFMLTDRENQSVLITGE
SGAGKTVNTKRVIQYFATIAALGGKKAEPTPGKMQGSLEDQIVAANPLLEAYGNAKTVRN
DNSSRFGKFIRIHFGTTGKLSSADIETYLLEKSRVTFQLSAERSYHIFYQLMTGHKPELL
EALLITTNPYDYPMISQGEITVKSINDVEEFIATDTAIDILGFTAEEKLSIYKLTGAVMH
HGNMKFKQKQREEQAEPDGTEAVADKIAYLLGLNSADMLKALCYPRVKVGNEMVTKGQTV
PQVNNAVSALCKSVYEKMFLWMVIRINEMLDTKQPRQFFIGVLDIAGFEIFD
Download sequence
Identical sequences I3IZY5
ENSONIP00000002175 ENSONIP00000002175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]