SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002181 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002181
Domain Number 1 Region: 442-743
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.84e-35
Family Extended AAA-ATPase domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002181   Gene: ENSONIG00000001741   Transcript: ENSONIT00000002181
Sequence length 817
Comment pep:known_by_projection scaffold:Orenil1.0:GL831140.1:576853:584448:1 gene:ENSONIG00000001741 transcript:ENSONIT00000002181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQRTYNQLWADAQLELSCLLAEELPAEPPRPEKDRVVFFQRLAMLFVRYTQIFRQLEKA
YDLVVHPQKRRFIRSVLDSVMGRVLELKNEMVEKEFSEYHYMDDVLHDLKLIPADLEIPI
PRYFHSERSKEVQQRKAMLTDILKMVEVTETPEPVMAKEMSQEEAVKIIQVAERARQGRE
RAKFNMKNLNMNTVYRIKEPGADSAESAAVCIQKVWKGYVQRKRTKTAREEEMIFLGMTM
DPKYEAPRPAEMTAQAIEASTRVKQMEHEEAYQKATVDVMNQLRDVEGDDMSKSMKVQIQ
QWFTECRNATGTFPDYPDEEDGGSALIFAEKTPQQLLEEFAAKEEEEANTKAKGKEEKKE
KGKSDKKKEDEEVEEAGLKMLPSAFLPDLEVESKIYADFWHNRSEYGNFNQMHDPELIKE
EKRKVIEAEIRVKVDEQMRQELAEWKLSVDKDKGGKTKANAKKKKGSKSGKKKKKEKDLT
ADRTLESLCQELVEQGLLKHTHNVQLQDFLGDYSYLGTTLRQHDIEPMPSLSDVRQVISL
YAVLPLGSQVVHEKAPLIKSVLLVGPTGVGKKMLVHAVCHETGACLFDLSPLNTAGKYPG
KSGLAMMLHLVFKVARLMQPSVIWIEDAEKMFYKKIPKEEKELDPKRLKKDLPKFLKLIK
GEDRVLIIGTTRDPHSAEIKSLCKMFSKILLIPRPDYGSRRILWKQLIRKHGGEVTEALD
LSSLAKISDGYTPGHIVQVIQSVLTKHRIFQQAKRPLTAAEFIAPLAQIDPVFQEEEEAL
KSWYAKTPLGKKRTKAASGKEEEEPPKGKNAKKKGKK
Download sequence
Identical sequences I3IZZ1
ENSONIP00000002181 XP_013123703.1.78416 ENSONIP00000002181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]