SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002194 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002194
Domain Number 1 Region: 5-193
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.85e-70
Family Nucleotide and nucleoside kinases 0.000000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002194   Gene: ENSONIG00000001750   Transcript: ENSONIT00000002194
Sequence length 197
Comment pep:known_by_projection scaffold:Orenil1.0:GL831140.1:627028:631870:-1 gene:ENSONIG00000001750 transcript:ENSONIT00000002194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGPRPVVLSGPSGAGKSTLLKRLMKEHEGVFGFSVSHTTRNPRPGEEDGKDYHFTTREA
MQEGIDKGEFIEHAEFSGNMYGTSKASVEDVRAKNLICILDVDIQGVKRIKETDLNPIYI
SIQPPSMEVLEERLRDRQTETEESLQKRLEAARADMELSKEPGVFDVVIINDDLEKAYEE
LKEILDEEIKKVQEAKS
Download sequence
Identical sequences I3J004
XP_005479246.1.78416 ENSONIP00000002194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]