SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002288 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002288
Domain Number 1 Region: 158-691,779-969
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.1e-256
Family Motor proteins 0.00000000147
Further Details:      
 
Domain Number 2 Region: 34-128
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000827
Family Ras-binding domain, RBD 0.02
Further Details:      
 
Domain Number 3 Region: 969-1022
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000903
Family Motor proteins 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002288   Gene: ENSONIG00000001830   Transcript: ENSONIT00000002288
Sequence length 1401
Comment pep:known_by_projection scaffold:Orenil1.0:GL831140.1:1069595:1115503:-1 gene:ENSONIG00000001830 transcript:ENSONIT00000002288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRDGAANMATTAGGGGGGGGQASPVDQDGRSYTLQIYPRLAAYPSTCCNLKVQKDATA
ASVISDATTALGLDPRRLYVLAEVKECGGEEWVLEAGDLPVQRFLLWPRKAQEQHPQSLG
FYFLLQERNRDGSIRYVHLPMLSKEQEAQRLAARGFLPPPQDDFADLCNLPVLSEDSILN
NLRTRFHKKKIYTYAGSILIAINPFKFLPIYNPKYVKMYENHQLGKLEPHIFAIADVAYY
AMLRKKVNQCIVISGESGSGKTQSTNFLIHCLTALSQKGYASGVERTILGAGPVLEAFGN
AKTAHNNNSSRFGKFIQVNYLESGVVRGAVVEKYLLEKSRLVSREKNERNYHVFYYLLLG
ASEEERKEFKLLPPEDYFYLKQQNFKIEDEEDLRHDFERLQQAMEMVGFLPATKKQIFSV
LSAILYLGNVTYTKKATGRDEGLDVGPPEVLATLSDLLKVKEELLVEALTKRKTVTVNDK
LILPYRHSEAITARDSMAKSLYSALFDWIVLRINHALLNKKDMEESVPCLSIGVLDIFGF
EDFETNSFEQFCINYANEQLQYYFNHHIFNLEQEEYQAEGITWHNIDYIDNVGCIHLISK
KPTGLLYLLDEESNFPHATDETLLAKFKQQHQCNKYFVPTPVMEPAFVIQHFAGKVKYHI
KDFREKNTDHMRPDIVALLRSSDRAYVRQLIGMDPVAMFRWGILRATIRGLAAFNEAGRT
WAAKTAGVIRPVTRTPLGELQRSNTSIERMYKKNKGIKIRQPIPKSLLDSRSLKFIVSLT
LQDRTTKSLLHLHKKKKPPSISAQFQTSLTKLLETLNRAEPFFIRCIRSNAEKKEMHLDE
ALVLQQLRYTGMLETVRIRRSGYGAKYTFQEFMEQFRVLLPKNATACKEDISALLEKKMG
LDPTTYQIGKTKVFLKELERQQLQDVLHKDVMRKIIFLQRWVRAHLQRKEFLELRQAAVT
IQRSWRRYRREEQRRRAATLIQAVWRGHRQRSENAKQRRGATKIQALVRGHSARRRCHSI
REEKRKKEEEEEEARRRAAEEERRRREEEEEARRKAEEEEQRRRMEEEEAARRRAEEEEE
AARKAKEQEQRLAEEPQTREDSDIELVTEEMLDKNLNAQGLEEEEQGEDVNRSSNSEEEH
GKEEELEREEMHSEACGNQAEAGPQLDEEEEDLERQTLEESESKADLASDRLISNALTPT
CPAEGEDKEASTTSTPPNAEQKRPQTSTVIRGLSTRSQEKREQRRQRGLEHSRRESERVA
SSSSTIKDPTTTPKSKNQEASKLKERSDSKELDQYTFVAWKVKEDKGAKKEAKSSPPSAG
PVRPSSLPLAPTDSLPERNGLSENVGAVNLQRRSGAIKEKPEKWKGRRSNGELSENISLS
PPQSREQTKKLYVFCRPRSAG
Download sequence
Identical sequences I3J098
ENSONIP00000002288 ENSONIP00000002288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]