SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002329 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002329
Domain Number 1 Region: 26-153
Classification Level Classification E-value
Superfamily Bromodomain 9.81e-43
Family Bromodomain 0.00018
Further Details:      
 
Domain Number 2 Region: 343-466
Classification Level Classification E-value
Superfamily Bromodomain 2.09e-41
Family Bromodomain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002329   Gene: ENSONIG00000001867   Transcript: ENSONIT00000002330
Sequence length 1452
Comment pep:known_by_projection scaffold:Orenil1.0:GL831149.1:5592767:5627306:1 gene:ENSONIG00000001867 transcript:ENSONIT00000002330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDGLDTAQMSGGSSSQGQVQQTCNPPPPEYINPNRPKRQTNQLQYLLKVVVKTLWKHQF
AWPFHAPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENSYYWNAQECIQDFNTMFTNCYIY
NKPGDDIVLMAEALEKVFLQKVTEMPQEETEIVVMTGKGRGRGRREGGLNLKPGAIMDPL
STTPQTRGLSALPTGLQTRGPVQGPPSLPPQPLMQALPGHVPPALSSHAPQLGAPYSLGQ
PDCPPQVPVMTSVPPPSQTSLPPATIQSTAPMLQTSMTMTKPRKSQKRKADTTTPTANDQ
LSESSPAESKSGKTLPRRESARPTKIKKDAPDSQHHIGLGMGLSGPSGGHSPKPQDQLGY
CASLVREMLSKKHAAYAWPFYKPVDVDALGLHDYHDIIKHPMDLSTIKAKLENRQYRDPQ
EFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPESKPLVSAPAPALHH
PAPVKPQPPLAHVASSSDSSSDSSSESESSTDDSEEERAQRLAELQEQLKAVHEQLAALS
QPQASKPKRKEKEKKEKKKDKHKRKGSMPVDEIQDATPLSQPSKKNKTSNNNNKEIVPKK
KPSKKEMMKAASLQPVPSLEDDPGATGSSVTGEKCKPMTYEEKRQLSLDINKLPGDKLGR
VVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVSSCLRKKKRVSVDKTMESMAT
SKKTGSSSDSSGSSSDSEMEGPGTIKQPKKKNHAVKEGKGKTHSHIQTVPAQATHQSQAA
GLQSSSQMKQQQHHHHHQPSPAGFMVPPVAPLESSQLLETSFDSLPPFGQSIMHLPHHTG
NSSSSPAPSHLNTHSAGPVSPETHPFLNQHSVLPSPALHSSMPQQPSRPSHKAAPLHPKP
PQQPAPPQQPQQQQQQQPPLQQQPPLQQQLQPQPQPQPTAPPPPQQHQLPPQILHSTQPL
HQRPISPPTLTPQGLLSSQPPQMLLEDDEEPVSTTPINQLFLPQFQQPRQTQQARQQQQQ
PVQTSLLQSVQTQSQLSSQTTLAPAQHPVQSQAQSAPSHQTLSQQMPLHQARHMQHTQQQ
QQQPQQQQVNYQHCPILPPQSQGTQHKASMPTNKTQQIIQQQQQEQPSPRPTKPDPYNTG
HMRDNPSPLMMNSPQLPQYPPVSHQSPPHNMQPKKQRAPGTQGVLKEEKLPPSPVMRGEP
FNPAMRPDHHKHPESKPCQPSHSQQNVKSMEGSRPVIRSSEPSGPPTSLQDKEKFKQESK
TPSAPKKVQDVKLKNMGSWASLAQKSTSTPLSAVKSSSDSFEQFRRAAREKEEREKALKA
QAEQAEKDRLRREQDKLRGRDEEEVMEQSRRMHDEPRRRLEQPHIQAPSQQHQQQQQQQQ
QQSVQQESQPAAIQQPPQPPTPPQLTTQNQLDQERERARLREQERRRREAMAATIDMNFQ
SDLMAIFEENLF
Download sequence
Identical sequences I3J0D9
ENSONIP00000002329 ENSONIP00000002329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]