SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002432 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002432
Domain Number 1 Region: 38-64,183-377
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-64
Family G proteins 0.00000000487
Further Details:      
 
Domain Number 2 Region: 68-189
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.02e-36
Family Transducin (alpha subunit), insertion domain 0.0000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002432   Gene: ENSONIG00000001943   Transcript: ENSONIT00000002433
Sequence length 379
Comment pep:known_by_projection scaffold:Orenil1.0:GL831166.1:1255777:1280402:-1 gene:ENSONIG00000001943 transcript:ENSONIT00000002433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQIYRATHRLLLLGAGESGKSTIVKQM
RILHVNGFNAEEKKQKIQDIKNNIKEAIETIVTAMSTLTPPVQLACPENQCRIEYILNFV
NQKDFDFPSEFYDHAKTLWQDEGVRACYERSNEYQLIDCAQYFLDKIDIVKQSDYTPTDQ
DLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNM
VIREDNQTNRLQEALNLFKNIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEEYFPEF
ARYTTPDDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRV
FNDCRDIIQRMHLRQYELL
Download sequence
Identical sequences I3J0P2
XP_003444814.1.78416 XP_013126542.1.78416 XP_013126543.1.78416 XP_013126544.1.78416 XP_013126545.1.78416 XP_013766284.1.53837 XP_013766285.1.53837 XP_013766286.1.53837 XP_013766287.1.53837 XP_013766288.1.53837 XP_014263023.1.88231 ENSONIP00000002432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]