SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002433 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002433
Domain Number 1 Region: 38-64,201-395
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.71e-64
Family G proteins 0.00000000639
Further Details:      
 
Domain Number 2 Region: 90-204
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 2.35e-35
Family Transducin (alpha subunit), insertion domain 0.00000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002433   Gene: ENSONIG00000001943   Transcript: ENSONIT00000002434
Sequence length 397
Comment pep:known_by_projection scaffold:Orenil1.0:GL831166.1:1257713:1279338:-1 gene:ENSONIG00000001943 transcript:ENSONIT00000002434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQIYRATHRLLLLGAGESGKSTIVKQM
RILHVNGFNADFPIGEHDMLSAAASLAYKEKKQKIQDIKNNIKEAIETIVTAMSTLTPPV
QLACPENQCRIEYILNFVNQKDFDFPSEFYDHAKTLWQDEGVRACYERSNEYQLIDCAQY
FLDKIDIVKQSDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQC
FNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKNIWNNRWLRTISVILFLNKQDLL
AEKVLAGKSKIEEYFPEFARYTTPDDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRH
YCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
Download sequence
Identical sequences I3J0P3
ENSONIP00000002433 ENSONIP00000002433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]