SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002475 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002475
Domain Number 1 Region: 9-369
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.53e-126
Family Motor proteins 0.000000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002475   Gene: ENSONIG00000001977   Transcript: ENSONIT00000002476
Sequence length 1042
Comment pep:known_by_projection scaffold:Orenil1.0:GL831166.1:1432138:1448383:1 gene:ENSONIG00000001977 transcript:ENSONIT00000002476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADAPAECNIKVLCRFRPLNQSEILRGDQFLPKFQGDDTVVVGGKSYVFDRVFPTNTTQE
QVYNTCAKQIVKDVLYGYNGTIFAYGQTSSGKTHTMEGKLHDPHQMGIIPRIAEDIFNHI
FAMDENLEFHIKVSYFEIYMDKIRDLLDVTKTNLSVHEDKNRVPYVKGCTERFVSSPDEV
MDVIDEGKNNRHVAVTNMNEHSSRSHSIFLINIKQEHVETEQKLCGKLYLVDLAGSEKVS
KTGAAGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIRNTASINLELTAEQWKRKYEKEKEKNKTLKETI
QKLESELNRWRNGEDVPETERTTSEIVTRIESVEERPILDNDTSSIVVRISEEERQKYEE
EIRKLYKQLDDKDDEINLQCQLVEKLKQQMLDQDELLASSRGDGDKVQAELGRLQVESDC
AKAEVKEVLQALEELAINYDQKSQEVEEKGLQNQLLAEQLSQKMASLMELEAELSRMQEV
SGQQRKRIAEVLNGLMRDLSEFSSIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVK
SMVKRCRQLENMQLECHRKMEETGRELSSCQLLISQHEAKIRSLTEYMQSVEQKKRQLEE
SHDSLSEELAKLQDQDNSLLEEKDGEKGETEDGNVKKALRHQGESHRGLHHKQLARLRDE
INEKQRIIDDLTDRNSKLELELAQVRADFERLKSQDSTKSERLEELSFLHERHEQTKQDL
KGLEETVARELQTLHNLRKLFVQDLTSRVKKSSEMEPDDSGGSCTQKQKISFLENNLDQL
TKVHKQLVRDNADLRCELPKLEKRLRSTAERVKALETALRDAKEGAMMDRRRYQQEVDRI
KDAMRAKNALRRPHAAQTAKPVRPKQLTVCSPTNPFYAYIRATEHANTYSNALFQSNVTP
QQSTSVSCNPNSVQSNTVSTALGYRAGRYNGDILESYPLNIDNGNSISEARDINDNRSDV
HCGSEVDDSNRHYMIQQETAAS
Download sequence
Identical sequences I3J0T5
ENSONIP00000002475 ENSONIP00000002475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]