SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002652 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002652
Domain Number 1 Region: 43-130,158-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000097
Family G proteins 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002652   Gene: ENSONIG00000002128   Transcript: ENSONIT00000002653
Sequence length 295
Comment pep:novel scaffold:Orenil1.0:GL831257.1:818402:821777:1 gene:ENSONIG00000002128 transcript:ENSONIT00000002653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSDHSETASHVKSSNVLYCKLSQKSTLSEEWRKIQWTGKNNDLQYINNYKPHNSELQHLR
ILLHGPVGAGKSSFINSVDTLLQGRMAARALADAGFGMSFTKQYRTFKIQKGGPGTFYPF
AFIDIMGLEKNTGVQVEDIKLAMKGHVKDGYKFNPGSPLSEHDHDYNKEPTLNDKVHVLV
CVIDPSKIKLMSDDLIKQMKAVRIAASEMGIPQMAILTKIDEACTEVKENIRNVYKSIWL
KEQMETVSASLGIPLNCIFPVKNYHSEIKTNDDVDVLILAALKQMINFGEDYVNN
Download sequence
Identical sequences I3J1B2
ENSONIP00000002652 ENSONIP00000002652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]