SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002655 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002655
Domain Number 1 Region: 24-213
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000885
Family ABC transporter ATPase domain-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002655   Gene: ENSONIG00000002130   Transcript: ENSONIT00000002656
Sequence length 275
Comment pep:novel scaffold:Orenil1.0:GL831257.1:850781:856824:1 gene:ENSONIG00000002130 transcript:ENSONIT00000002656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGVFSQSWRPLPKNNQDTLDFLKSYRPRNHEASHLRILLIGPSGDGKSTFINSVDSVLQ
GRVANRAPTDQHLTADSFTKKYKTYKFSKGNEGDYSFVFNDIMGMERTKGIHVEDVKLAL
RGHVKDDYEFDPENKLEEGAPKYNAAPELSDRVHVLVTVVPACSVSLLPPDMIAKLRDIR
LAATALEIPQLAILTKVDVACRKAQRNVNNIYKSDYLKEQVYKFGQFLGLPVNSIFLVKN
YSSEISTNDATDAHILCALKQMVVFGEDYLNHLND
Download sequence
Identical sequences I3J1B5
XP_003452892.1.78416 ENSONIP00000002655 ENSONIP00000002655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]