SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002838 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002838
Domain Number 1 Region: 1-22,150-319
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-54
Family G proteins 0.000000025
Further Details:      
 
Domain Number 2 Region: 22-152
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.14e-38
Family Transducin (alpha subunit), insertion domain 0.00000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002838   Gene: ENSONIG00000002275   Transcript: ENSONIT00000002839
Sequence length 325
Comment pep:novel scaffold:Orenil1.0:GL831140.1:3575689:3589051:-1 gene:ENSONIG00000002275 transcript:ENSONIT00000002839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTGESGKSTFIKQMRIIHGSGYTDEDKKGFTKLVYQNIFTSMQAMIRATENLKIPFKYDQ
NKENCSRDFLVLLTTQRAFTLQVLCWLKSFPEPYISAIKMLWADPGIQEAYDRRREYQLS
DSTKYYLSDLDRIADPSYLPTQQDVLRVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERR
KWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLN
KKDLLEEKIMYSHLVDYFPEFDGPQRDAQAGREFILKMFVDLNPDSDKIIYSHFTCATDT
ENIRFVFAAVKDTILQLNLKEYNLV
Download sequence
Identical sequences I3J1U8
ENSONIP00000002838 ENSONIP00000002838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]