SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000002839 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000002839
Domain Number 1 Region: 1-22,139-308
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.08e-54
Family G proteins 0.0000000226
Further Details:      
 
Domain Number 2 Region: 22-141
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 2.75e-41
Family Transducin (alpha subunit), insertion domain 0.00000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000002839   Gene: ENSONIG00000002275   Transcript: ENSONIT00000002840
Sequence length 314
Comment pep:novel scaffold:Orenil1.0:GL831140.1:3575689:3589051:-1 gene:ENSONIG00000002275 transcript:ENSONIT00000002840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTGESGKSTFIKQMRIIHGSGYTDEDKKGFTKLVYQNIFTSMQAMIRATENLKIPFKYDQ
NKNNALQVREVDVEKVASFDQPYISAIKMLWADPGIQEAYDRRREYQLSDSTKYYLSDLD
RIADPSYLPTQQDVLRVRIPTTGIIEYPFDLQSIIFRMVDVGGQRSERRKWIHCFENVTS
IMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMY
SHLVDYFPEFDGPQRDAQAGREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVK
DTILQLNLKEYNLV
Download sequence
Identical sequences I3J1U9
ENSONIP00000002839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]