SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003026 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003026
Domain Number 1 Region: 661-786
Classification Level Classification E-value
Superfamily Bromodomain 4.97e-39
Family Bromodomain 0.00000156
Further Details:      
 
Domain Number 2 Region: 465-614
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.16e-19
Family N-acetyl transferase, NAT 0.0000000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003026   Gene: ENSONIG00000002420   Transcript: ENSONIT00000003027
Sequence length 792
Comment pep:known_by_projection scaffold:Orenil1.0:GL831161.1:1722224:1734514:-1 gene:ENSONIG00000002420 transcript:ENSONIT00000003027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSAGIQQGSPAIGAAGLVPAAPGAGGTEGSGAARGSARIAVKKAQLRSSPRPKKLEKL
GVYSSCKAEGACKCNGWKSQNPPPTPPQTEQQSNAVNLQEPCRSCSHTLGDHVTHLENVS
EEEMNRLLGIVLDVEYLYTCIHKEEDADTKQVYFSLFKLLRKSILQMGKPMLEAQESPPF
EKPSIEQGVNNFVQYKFSHLPSKERQTIMELAKMFLNQINYWQLETPSQRRQRVPNDDAA
GYKVNYTRWLCYCNVPQFCDSLPRYETTQIFGRTLLRSVFTVMRKQLLEQARQEKDKLPP
EKRTLILTHFPKFLSMLEEEVYSHNSPIWSQDFLAGAAGGQIPIHTVISAASVARPLYYS
TSPVSVDPSTCGSVSPARKAASVLEPNPAGEKRKPSEPLPHEENKRPRVVGDIPMDLINE
VMATITDPAAIPETSLLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKRILMWLVGL
QNVFSHQLPRMPKEYITRLVFDPKHKTLSLIKDGRVIGGICFRMFPSQGFTEIVFCAVTS
NEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKSKYVGYIK
DYEGATLMGCELNPSIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQI
PIESIPGIRETGWKPVGKGKELKDPDQLYSTLKTILQHVKSHQNAWPFMEPVKKTEAPGY
YQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLLEKFF
YTKIKEAGLIEK
Download sequence
Identical sequences I3J2D6
XP_003444106.1.78416 ENSONIP00000003026 ENSONIP00000003026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]