SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003048 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003048
Domain Number 1 Region: 1142-1383
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.76e-72
Family ABC transporter ATPase domain-like 0.0000274
Further Details:      
 
Domain Number 2 Region: 535-743
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.38e-57
Family ABC transporter ATPase domain-like 0.0000325
Further Details:      
 
Domain Number 3 Region: 815-1130
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 9.94e-54
Family ABC transporter transmembrane region 0.0058
Further Details:      
 
Domain Number 4 Region: 131-431
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 1.44e-23
Family ABC transporter transmembrane region 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003048   Gene: ENSONIG00000002436   Transcript: ENSONIT00000003049
Sequence length 1390
Comment pep:known_by_projection scaffold:Orenil1.0:GL831169.1:1639591:1667177:1 gene:ENSONIG00000002436 transcript:ENSONIT00000003049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPDALEAAGCVEGLSLPSLQPLPELEEEEAEASLERGPKRPGRYRKSLQLLKPFRIRHK
HQHPVDNAGLFSFMTLHWLSPLAVKAYKASSLSIDDVWGLSCHEASAVNCQRLEYLWHEE
LKRSGREGASLTRVFWRFCQTRTLVAVFSLLLTMVAGFVGPAILVKSLLEYSQSSESSVW
YGLSLAAGLFLMELIRSWSLGLMWGVNYRTAARLRGAALTLAFHKILRLRSTKDISPGEL
INICSSDGQRLYEAVCMGCLLAGGPLVGILGLSYTAFFLGPTALIGSSIFIIIYPVMMLA
SRLTAYFRKKCVTVSDQRVRLMNEILGCIKFIKMYCWEDAFAKNIRKVRLEERSILERAG
NVQSITVGLSPITVVLASVCTFSLHMALGYDLTAAEAFTVVAVFNAMTFALKVTPLAVRS
LSEAAVAVKRFQRLFMMDDREEVVEKMEDPGNAVEFQVATLAWEKAKGKKPNPAPKKRGV
MKHVLRREKLSLYISTEDGKGNKENPNVQSLLTNMEQESPQSTVSSTQSIRPPLHKTLHR
INLRIKKGSLVGICGGVGSGKSSLLSALLGQMTLLEGKVAVSGGFAYVSQQAWILNDSLK
ENILFGNKYNPDKYNAVLEACCLLPDIAELPYGDMTEIGERGANLSGGQRQRVSLARALY
SELPILLLDDPLSAVDACVGSHIFSKAIRGAAKGKTILFVTHQLQYLPECDVVILMKDGQ
IAEHGTHAQLIGKDRNYAMLFNSMQQENLVKEKLKSKEQRVGGKKADSAVDVAKVGPKVE
SKKGEPLMKAEEKGSGAVPWSVYGAYIKAAGGPVVFVINIFFFFSTTGSLAFSNWWLSHW
IRQGSGNTSLISVNETIASNSMRLNPHIRYYSTVYIISMGAALLLKTIRGLVFVKCTVKA
ASVLHDKLFSRILHCPMHFFDTTPLGRILTRFSRDMDEVDVRLTMQAEMLLQNLSLVLLC
LGMVGMVFPWFLISVLPLGGFLYIVNHLSRVLLRELKRLENISQSPFTSHITSSLQGLST
IHAYGRGHDFLQRYQELLDTNQASNYLFSCAMRWLAIRLDLISISLITAVALLIVFMHNQ
IPPAYAGLAISYAVQLTGLFQFTMRLLTETEARFTSVERINHYIKTLESEAPRQSPEAAQ
PAPSWPPEGKITFQDVEMRYRNDLPLVLKNLSFTILPEETIGIVGRTGSGKSSLGVALFR
LVELTGGSIIIDGINVAQIGLDDLRSKLAIIPQEPVLFIGTIRSNLDPWDQYSDAEIWEA
LEKTHIKEMVSQLPHSLHSEVTENGENFSVGERQLLCVARALLRNSKILLLDEATAAIDT
ETDRLIQETIRTAFGSCTTLIIAHRLNTVMSCSRVMVMNNGQILEFDSPVALLADENSRF
RAMVEASENQ
Download sequence
Identical sequences I3J2F8
ENSONIP00000003048 ENSONIP00000003048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]