SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003064 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003064
Domain Number 1 Region: 32-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.92e-64
Family SPRY domain 0.0000000193
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.000034
Family SOCS box-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003064   Gene: ENSONIG00000002449   Transcript: ENSONIT00000003065
Sequence length 273
Comment pep:known_by_projection scaffold:Orenil1.0:GL831166.1:4431089:4435582:1 gene:ENSONIG00000002449 transcript:ENSONIT00000003065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKVPGGIKTIDMRDPAFSPLKLELQALNHTKPSRLDLLLDMPPASLDIQVQHSWNNDD
RSLNVFVKDDNKLVFHRHPVAQSTDAIRGRVGYTRGLHVWEISWAMRQRGTHAVVGVATS
DAPLHSVGYTALVGSNAESWGWDLCRSKLYHDGKNHPAKPYPAFLEPDDTFIIPDSLLVV
LDMDEGTLGYIVDGHYLGVAFRGLKGRKLYPVVSAVWGHCEIRIRYINGLDPEPLSLMDL
CRRSVRVALGRERLSEIHRLPLPASLKNYLLYQ
Download sequence
Identical sequences I3J2H4
ENSONIP00000003064 ENSONIP00000003064 XP_003444860.1.78416 XP_004554284.1.88231 XP_005732923.1.53837 XP_005732924.1.53837 XP_005914981.1.24487 XP_005914982.1.24487 XP_005914983.1.24487 XP_006785612.1.46954 XP_006785613.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]