SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003131 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003131
Domain Number 1 Region: 50-77,194-373
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.52e-58
Family G proteins 0.000000089
Further Details:      
 
Domain Number 2 Region: 81-201
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.27e-41
Family Transducin (alpha subunit), insertion domain 0.00000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003131   Gene: ENSONIG00000002498   Transcript: ENSONIT00000003132
Sequence length 374
Comment pep:known_by_projection scaffold:Orenil1.0:GL831166.1:4545251:4550631:1 gene:ENSONIG00000002498 transcript:ENSONIT00000003132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIVVYSEYLKIVTTSDLEFEEEESMGAGASAEDKKSKELEKQLQEDADKESKTVKLLLLG
AGESGKSTIVKQMKILHQGGYTKEEQLEFRAIIYGNILQSALAIIRGMEMLGIDFGSSSG
QEDSQKLQNLSDSIEEGTMPPELADVIQKLWKDSGVQAAFERAAEYQLNDSAGYYLNEMD
RICKPEYMPTEQDVLRSRVKTTGIIEEQFSCKELHFRMFDVGGQRSERKKWIHCFEGVTC
IIFCGALSAYDMVLVEDDEVNRMHESLHLFNSICNHRFFALTSIVLFLNKKDLFEEKIKK
VHLSICFPDYDGPNTYDDASNYIKTQFLELNMKKGVKEIYSHLTCATDTKNVEIVFNAVT
DIIIKENLKDCGLF
Download sequence
Identical sequences I3J2P1
ENSONIP00000003131 ENSONIP00000003131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]