SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003136 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003136
Domain Number 1 Region: 55-84,202-371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.47e-60
Family G proteins 0.0000000451
Further Details:      
 
Domain Number 2 Region: 84-204
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 9.94e-44
Family Transducin (alpha subunit), insertion domain 0.000000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003136   Gene: ENSONIG00000002502   Transcript: ENSONIT00000003137
Sequence length 377
Comment pep:known_by_projection scaffold:Orenil1.0:GL831166.1:4557394:4572414:-1 gene:ENSONIG00000002502 transcript:ENSONIT00000003137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVDIKFKLSLVANIRTLERKEKMGCTISAEDKAAVERSKMIDKNLREDRDKSSKEVKLL
LLGAGESGKSTIVKQMKIIHEDGYSEEECKQYKVVVYSNTIQSIIAIIRAMGQLKIDFGD
EARADDARQLFALAGSADEGVMSAELTSVIQRLWSDAGVQACFDRSREYQLNDSAAYYLN
DLERICQPDYIPTQQDVLRTRVKTTGIVETHFTFKELNFKMFDVGGQRSERKKWIHCFEG
VTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTLTSIILFLNKKDLFEEK
ITRSPITICYPEYTGESTYKEAADYIQCQFEDLNKRKDIKEIYTHRTCATDTKNVEFVFD
AVTDVIIKINLREIGLY
Download sequence
Identical sequences I3J2P6
ENSONIP00000003136 ENSONIP00000003136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]