SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003166 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003166
Domain Number 1 Region: 24-279
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.98e-28
Family G proteins 0.015
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000003166
Domain Number - Region: 345-399
Classification Level Classification E-value
Superfamily Gam-like 0.0123
Family Gam-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003166   Gene: ENSONIG00000002528   Transcript: ENSONIT00000003167
Sequence length 432
Comment pep:known_by_projection scaffold:Orenil1.0:GL831169.1:2726946:2739089:-1 gene:ENSONIG00000002528 transcript:ENSONIT00000003167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTEIARQAGEGARGVPLSGHVGFDSMPDQLVNKSVNHGFCFNILCVGETGLGKSTLMD
TLFNTKFEGEPTQHNQPGVTLKSNTYELQESNVRLKLTVVNTVGFGDQINKEDSYKSIVE
FIDAQFEAYLQEELKIKRTLHSYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNII
PIIAKSDAISKSELAKFKIKITSELVSNGVQIYQFPTDDESVAEINSTMNSHLPFAVVGS
TEEVKIGNKMVKARQYPWGTVQVENETHCDFVKLREMLIRVNMEDLREQTHTRHYELYRR
CKLEEMGFKDTDPDSKPFSLQETYEAKRNEFMGELQKKEEEMRQMFVQRVKEKEAELKEA
EKELHEKFDRLKKLHQDEKKKLEEKKKSLDDEVNTFKQKKTAAELLQNQAQQAGGSTTLK
RDKERKNHSNFL
Download sequence
Identical sequences I3J2S6
ENSONIP00000003166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]