SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003174 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003174
Domain Number 1 Region: 7-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.12e-61
Family G proteins 0.0000000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003174   Gene: ENSONIG00000002535   Transcript: ENSONIT00000003175
Sequence length 218
Comment pep:known_by_projection scaffold:Orenil1.0:GL831140.1:5879795:5887346:1 gene:ENSONIG00000002535 transcript:ENSONIT00000003175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKSILTEIYRIVSQKQ
ISDRSAHEDSPGNNVVDISVPPTMDGQRGNKLPCCQSL
Download sequence
Identical sequences I3J2T4
XP_019206985.1.78416 ENSONIP00000003174 ENSONIP00000003174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]