SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003300 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003300
Domain Number 1 Region: 162-242,343-456
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.21e-38
Family G proteins 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003300   Gene: ENSONIG00000002635   Transcript: ENSONIT00000003301
Sequence length 646
Comment pep:known_by_projection scaffold:Orenil1.0:GL831309.1:513913:520026:-1 gene:ENSONIG00000002635 transcript:ENSONIT00000003301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKKAGGGAVLGRALIKERLQAGRGNKRGDSWLHTSELNDGYDWGRLNLQSVTEQSSMD
DFLATAELAGTEFVAEKLNIKFVPAEARAGLLTAEEKSELMKLHEDNKHFLRIPRRPHWD
ESTSPDELQQTEKDSFLEWRRALAQLEEEQKLILTPFERNLEFWRQLWRVIERSDVVVQI
VDARNPLLFRCLDLESYVKEVSEHKVNMLLVNKADLLTREQRQVWAKYFEKEGLRAVFWS
ALAESNRLDAEEKGMEVADPECEESDPEEGGWQIKEVVRQKGADGEEEVKNKEEEDEDKG
GEQSDIEEEQEEVSVDEEDWKTCSEGEEEAEGGTAGSSDASFHNSSRLLRKDELLEMFKA
VHNGSRVKEGQLTVGLVGYPNVGKSSTINTILRNKKVSVSATPGHTKHFQTLYVEPGLCL
CDCPGLVMPSFVSTKAEMICSGILPIDQMRDHVPAISLIGHICQTIPRHVLEGTYGINII
RPREDEDPDRPPTAEELLMAYGYMRGFMTSHGQPDQSRSARYVLKDYVSGKLLYCHPPPH
IKPEDFQPQHKKFENRDSDSSDLSTVMNRQRKIKRIENVVDKNFFHQENVRALSKGIQSV
MGYKPGSGPVGPGKAESEMAVGKPWKKHSNRNKKEKVRRITKHLDA
Download sequence
Identical sequences I3J360
ENSONIP00000003300 ENSONIP00000003300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]