SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003312 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003312
Domain Number 1 Region: 13-813
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-279
Family Motor proteins 1.09e-16
Further Details:      
 
Domain Number 2 Region: 815-913
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000384
Family Motor proteins 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003312   Gene: ENSONIG00000002644   Transcript: ENSONIT00000003313
Sequence length 1890
Comment pep:known_by_projection scaffold:Orenil1.0:GL831133.1:1563435:1607435:-1 gene:ENSONIG00000002644 transcript:ENSONIT00000003313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IASSHMYSQSARVWIPDAEEVWKSAELTKDYKSGDVSLQLMLEDGKNIEHKLDPKTRNLP
YLRNPDILVGENDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYETLPIYG
TDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYF
ATVSGSASEANVEEKVLASNPIMEAIGNAKTTRNDNSSRFGKYIEIGFDNRYRIIGANMR
TYLLEKSRVVFQADEERNYHIFYQLCASAHLPEFKALKLSSANDFLYTRQGRSPVIDGVD
DTKELCTTRNAFSLLGINESYQMGLFQVLAAILHLGNVEIKDRDADSSVIPPNNRHLMAF
CELVGVTYQDMSQWLCHRKLKTATETYIKPLPRLQATNARDALSKHIYAKLFNWIVEHVN
KALVTNVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKE
QIPWTLIDFYDNQPCINLIEAKMGVLDLLDEECRMPKGSDDSWAQKLYNTHLKTCSLFEK
PRMSNRAFIIQHFADKVEYQCEGFLEKNKDTVNEEQINVMKASKKFDLLVELFQDEEKAT
SPTGHVQGTGGRTRLSIKPDKSRDTSSKEHKKTVGCQFRNSLQMLMDTLNATTPHYVRCI
KPNDFKLAFSFDPKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLA
DKKLTCKNVLEKLVQDQDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRCWL
ARKKYLRKRSAAITIQRFTRGYQARCLAKFLRRTQAATIIQKYQRMYVERKRYKQKQAAA
LAMQTILRAYMARQKYQALLREHKAVIIQKHVRGWLARCWYKRCLEAIVYLQCCIRRMRA
KRELKKLKIEARSVEHFKKLNKGMENKIMQLQRKIDEQSKENRLVNERLVSLESSYTVES
ERMRGELSRLRGVEEDAKNKANQVSSLLEELERLKKELSATQQEKKTIEDWAQSYRDEME
KMVAELKDQNGLLKKEKDDLNRLIQEQSQQMTEKMTRAIAEETQQLETDLNEERSRYQNL
LSEHLRLEEKYDDLKEEMALSSNVSKPGHRRTDSTHSSNESEYTYNSEYAELEDGTRGRE
DVTRGIDTSLTLKLQKRVTELEQDKQLLRNELENREEQLQRASAMSDDGYFQARGAELEY
ESLKRQELESENKKLKHNLEEMRKSLLGNAATGAGAPGSPAYKVLLEQLSASCEELEVRK
EEVLILRSQLVSQKEAMHHKETMTEPSVYKDDVSKLKDDEVKQAYVGLKDTNRSPRFMRQ
QMEVSDLLSRLRSAAPDLRKLNEDGELWLVNQGLKETIRLLEHQLQTQRRTYDNEVESLR
SELQNVKEENNRQQQLLAQNLQLPPEARIEASLQHEITRLTNENLELMADDPTASREARV
VILRRMVDLMEQLEKQDRTIRKLKKQLKVYSKRIGEMGAGQTEGQTSPGQMVDEPIHPVN
IPRREKDFQGMLEYKKEDEMKLVKNLILELKPRGVAVNLIPGLPAYILFMCLRHADYVND
DQKVRTLLTSTINSIKKILKKRGDDFETVSFWLANTCRFLHCLKQYSGDEQFMKHNTSRQ
NEHCLSNFDLAEYRQVISDLAIQIYQQLIKCMENILQPMIVSGMLEHETIQGVSGVKPTG
LRKRTSSIADEGTYTLDSILRQLSAFHSTMCQHGTDPELIKQVVKQQFYIIGAVTLNNLL
LRKDMCSWSKGMQIRYNVSQLEEWLRDKGLMTCGAKETLEPLIQAAQLLQVKKKTDEDAE
AICSMCHALTTAQIVKVLNLYTPVNEFEERVSVAFIRTIQTRLRDRCESPQLLMDTKMIY
PVTFPFNPSCLALETIQIPSSLNLGFLTRV
Download sequence
Identical sequences I3J372
ENSONIP00000003312 ENSONIP00000003312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]