SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003314 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003314
Domain Number 1 Region: 21-171
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.86e-30
Family G proteins 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003314   Gene: ENSONIG00000002645   Transcript: ENSONIT00000003315
Sequence length 415
Comment pep:known_by_projection scaffold:Orenil1.0:GL831169.1:3277542:3282111:1 gene:ENSONIG00000002645 transcript:ENSONIT00000003315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNLMSNCCNWVSKIQEPIRKVTILVVGLDKAGKTSSIRGMLRVANVVESGPTHGCIRHE
LRVENYLVTLLDVGGSAESRGTWRELYGEAHGIIFVVDSGDRQMIKEVREVLSDLLKQPR
VAGKPLLVLANKQDKMNALLSSELIEILSLEKLVNQSRSLCHIEPCSALMDLRRWSDRKT
LRGLRWLLRAVCLDYPELCARVAQDSKRPLEPRERERNGKPEKVQRKTKVERIRSSKSDL
RKVHRPKDKEKKPKSEGKLQPIRNMLQKDTSLKKKLKTKKKKKTVKVKEGEKDEGPANEH
EEEEDGDANEGEQENSGHRDKASSALIPPKKGKLKRKTKVKEETLDVPESPENDEKPLKV
KGEKKKKKRVVKVKRKNKINTEEMPAAYSQPVDLSATFDLYRKAILALKERQDQG
Download sequence
Identical sequences I3J374
ENSONIP00000003314 ENSONIP00000003314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]