SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003477 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003477
Domain Number 1 Region: 3-302
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.42e-89
Family G proteins 0.000000000515
Further Details:      
 
Domain Number 2 Region: 518-625
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-24
Family Pleckstrin-homology domain (PH domain) 0.00000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003477   Gene: ENSONIG00000002772   Transcript: ENSONIT00000003478
Sequence length 804
Comment pep:known_by_projection scaffold:Orenil1.0:GL831140.1:6926739:6946692:1 gene:ENSONIG00000002772 transcript:ENSONIT00000003478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRGMEDLIPLVNRLRDALSSVGESCSLHLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLILQLLSDNTEYGEFLHCQGKKFTDFDEIRKEIETETRRLTGSNKAISPVPI
HLRIHSPHVLNLTLVDLPGITKVPVGDQPTDIEYQVRDMIMQYICKENCLILAVTPANTD
LANSDALKLAKDVDPQGLRTIGVITKLDLMDEGTNARQILENKLLPLRRGYIGVVNRSQK
DIDGKKDIKEALRAEKEFFLSHPAYKHMSEKMGTPYLQRILNQQLTNHIRDTLPAFRSHL
QSQLLALKKEAEDYMQFNPNDSARRTKTLLQLVQRFAVDFDKLIEGSGDKVDTVNLSGGA
KINRIFHERFPYELIKIGSDEGKLRTEINYAIRNTHGVRTGLFTPDTAFEAIVKKQISRL
KGPCVKFIDMVSQELTTTVYQCIDKLSSFPKLRDETERIVTTEIRELETKCRDQVMLLID
IQLAYINTKHEDFVGFNNSPQMHNHSNTKIAARMGGNQVIRKGWLTINNIGIMKGGAKEY
WFILSAENLSWFKDDKEKEKKYMLPLDNLKLRDVEKGFMSSKYVFAIFNTELRNVYKDYK
CLELACNSQEELDSWKASLLRAGVYPEKVAVDGQGNGPPENLSDPQLERQVETISNLVDS
YMGIIYKTVRDLMPKTMMHLMINSVKEFISSELLAQLYALGECSALMDESPEQQQHRVEV
LQKHAALKEALAAIGEISTSTCTTPLPPPVDSSWIKPSSHAPPVPRVPSAGPKSSPNGSR
QPTSQQNRTPALVPSSPLSLVPPL
Download sequence
Identical sequences I3J3N7
ENSONIP00000003477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]