SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003557 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003557
Domain Number 1 Region: 732-979
Classification Level Classification E-value
Superfamily RNI-like 6.28e-48
Family 28-residue LRR 0.0073
Further Details:      
 
Domain Number 2 Region: 114-187
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000127
Family Caspase recruitment domain, CARD 0.0045
Further Details:      
 
Domain Number 3 Region: 14-82
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000565
Family Caspase recruitment domain, CARD 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000003557
Domain Number - Region: 272-443
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00015
Family Nucleotide and nucleoside kinases 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003557   Gene: ENSONIG00000002837   Transcript: ENSONIT00000003558
Sequence length 986
Comment pep:known_by_projection scaffold:Orenil1.0:GL831133.1:4416524:4422809:-1 gene:ENSONIG00000002837 transcript:ENSONIT00000003558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAEELVLKQRTKILHALCSSGSAEHLERVLDILLAKGALIWEDYQNIQVPGRTLYTNAR
QLLDLVYTKGVDTCGLFLAALKLALPEAQAVGLSFSESCSNLQENDECQSTSNQTLLAQR
PSLVHKLQGCVDGVLAALLDSGHFSSADCDEVRLPIYTPTQQARRLLDHVRSRGDLAASV
LLQYIHQKQEPGLPLNQRELTPPKEFLKYQKKLSSSVSAQACFLSTYAGTSHMSLDDIYT
DGQLELAEVNAHGPLGLEDIVGLVGIVNEEADTVLVSGEAGSGKSTLLQRLHLLWARGVA
LQDFLLLFPFSCRRLNSEHNELSVQELLFQHCCWPDRNQEEIFQFILDHPHQILFTFDGL
DELKQSFTDEHRVCCPTQRAPVHVLLFNLIQGSLMKGVQKVVTSRSEAVSPLLKKHLRKE
VVLKGFSPTGIDSFVRKHHRDPTVAAKVLESMQANTALLGLCHSPVLCWIVSQCHKELLG
CGEGSPKTITDVYLMILQHFLQHQSPLKSTMGLGWLQEHLKTVLLLGQLAFEGITSTCYI
FSGTDLEACGVTEKDICMVFLIKSKDMSSTHSKCYEFSHVTLQCFFAALFIVLSSNTNRS
VIPKLFELENRETGLTRVCFTACLPSSDQQQQASEKESKAAETPNLQITAMFVSGLLSQR
HQNLWLHCCPSAAVEKKARQVARCLSKGIQKHFRSIPQPVQGEKKSMHAMPDFVWLIKCL
YEMQESRIAKDAMSKLEVDHLKLTYCNIGPVECTALAYVLQHLRNPVGLQLDNNSVGDVG
VEQLLPCMHICNSLYLRNNNITDEGIRKLIAKVIQCDSFQKIALFNNKLTDACMQDFSYL
LKTKQVFISLRLGNNNITAEGAKQLAEGLKANQTLAYLGLWGNRIGDAGTEALASSLERS
NSLVWLSLVGNGVGSAGACALANLIRKSTSLQELWLTENCITRTGVECLIQALKHNTHVT
SVWLRNNDLSLEDAEEMKQLESRLIF
Download sequence
Identical sequences I3J3W7
XP_003437591.1.78416 ENSONIP00000003557 ENSONIP00000003557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]