SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003770 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003770
Domain Number 1 Region: 8-287
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.68e-84
Family PAPS sulfotransferase 0.000000858
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003770   Gene: ENSONIG00000003011   Transcript: ENSONIT00000003771
Sequence length 287
Comment pep:known_by_projection scaffold:Orenil1.0:GL831173.1:684171:687982:-1 gene:ENSONIG00000003011 transcript:ENSONIT00000003771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLDVTEMFHGISFPGHLHTQDSLKYAVSFPFGDTDILIVSYPKSGTTWIQEVVSLIHT
RGNPGLSQTVENWKRAPWLEHYYSSALLEASPTTARVITTHLPHHLLGPALQHSKTKVIY
VSRNPKDVVVSFYHFHKMANFLPEPHSFPEFLDRFLEGTVSFGSWFDHIKGWTSQINSNL
LHVTYEEMSLDLHSTIKKISSFLQCPLVEDEVNNCVKHCSFSSMKENKMINYTLVPQEIM
DHSKGSFMRKGKVGDWKNMFTEEDNRKFETVFTSQMMENCTLEFVWE
Download sequence
Identical sequences I3J4I0
ENSONIP00000003770 XP_003445797.1.78416 ENSONIP00000003770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]