SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003773 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003773
Domain Number 1 Region: 4-362
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.98e-127
Family Motor proteins 0.00000000326
Further Details:      
 
Domain Number 2 Region: 1797-1869
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.44e-26
Family Cap-Gly domain 0.00017
Further Details:      
 
Domain Number 3 Region: 444-544
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.46e-23
Family FHA domain 0.0006
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000003773
Domain Number - Region: 891-963
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00425
Family PLC-like (P variant) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003773   Gene: ENSONIG00000003013   Transcript: ENSONIT00000003774
Sequence length 1869
Comment pep:known_by_projection scaffold:Orenil1.0:GL831286.1:1365621:1402787:-1 gene:ENSONIG00000003013 transcript:ENSONIT00000003774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTKVKVAVRVRPMNRREIELNTKCVVDMEDNQTVLHPPPSNAKGENRKQPKVFAFDHC
FWSMDESNVPKYAGQEVVFKCLGEGILENAFQGYNACIFAYGQTGSGKSFSMMGNGEQPG
LIPRLCCSLFERVHRETNEGHSFKVEVSYMEIYNEKVRDLLDPKGSRQSLKVREHKVFGP
YVDGLSQLAVTSFEDIEVLMSEGNKSRTVAATNMNEESSRSHAVFSIIVTQTLYDLQSGN
SGEKVSKMSLVDLAGSERVSKTGAAGERLKEGSNINKSLTTLGCVISALADQSAGKGKAK
FVPYRDSVLTWLLKDNLGGNSKTAMIATVSPAADNYEETLSTLRYADRAKRIVNHAVVNE
DPNARIIRELREEVEKLKVQLSQAESMKAPELKEKLQESEKLIQEMTVTWEEKLRKTEEI
ATERQKQLESMGISLETSGIKVGEDKCFLVNLNADPALNELLVYYLKEHTRVGADTSQDI
QLFGIGIQPEHCVLELCPDGDVTLMPIGNARTCVNGTMIDSLVHLWHGDRILWGNNHFFR
INLPKRKRRDRLKELERASPRESFVEADIETASEASSEQDYTYEFAQMEVIMKTLGNNDP
MQNVVQVLEKQYLEEKRTALEEQRMMYERELESLRQQLSPEKTSQHHRSSSDRLTFSTHA
PHSKLRLWTEERDELFRQSLSRLREQVVKANTLVREANFLAEEMNKLTDYQVTLQIPAAN
LSANRKRGAIVSEPAIQVRRKGKGTQVWTIEKLENKLVDMRDHYRDWKEGTEETYNKASS
KHCDPFYEAQENHNLIGVANIFLECLFHDVKLQYAVPIISQQGEVAGRLHVELMRVSGAV
PERLCSGDDSSENSSENSCYEVMDTNGEIVHMAKRLTCRVRIRDATGLPLNLSNFVFCQY
TFWEHGEPTVAPPMVSPDRPSPRSPDAQFTVQFDHCKDYVVHVTDEFLEFISDGALAIEV
WGHRCAGNGRSLWELDALEAKTQTLRDRWSEVSRRIELWIAIQELNEQGEYASVELQPGK
DISTGGVFQLRQGHSRRLQVSVKPVQNSGTLPLLVEAVLSVSIGCVSARSTKLQRPLDSY
QREMEDDMDSYQEEDLNCVRERWSDALIKRREYLDEQIKKIINKQEKSEEDIEREARLVE
QWVGLTEERNAVLVPAPGSGIPGAPADWTPPAGMEAHIPVLFLDLNADNLTVNEQLTGPH
AAGVNSILPKEHGSQFFYLPIIRHSDEEVSAVCSWDSSIHDSVHLNRVTSPNERIYLIIK
ATVQLSHPASMELVLRKRIAVNIYNKQSFTQSLKRRMSLKNMLYSCGVTYEIVSNIPKAS
EEPEERETLALMAARGDSEETQDGETYIEKYTRGVLEVENILSLERLRQAVTVKEALAAK
GRHLRRSISTPNVQQSLCSKTDLTGCEDEDCKDGSLCTTPVKKESSGNLRKSTCVETSRS
DFRVNTECSHTGLVPESSTFFIASPFKVLSPQPPKFLKSLLPVKEENKAKKVLEARPLLG
HEVRRMEYINSSSLFKNGLMHVLSATHAVTNIRPEDFANFEIYNATLESQEGFRSDLKGS
RCGGGSSEREVPRSPTTSSCTSGYFSHSASNATLSDMPFSANGVQDLLIHSASSPISIPN
CTDKPQSFPSPNNCVLSTKGWEEEGLEVCTNEQKKTDNVETRDTDNQLTSDVSGILKTSL
PEKTICKCPNYENAVSVAVSCPNTTVFCTSVRAPVSTSAPCPAQINPAASVPPPQSPSPL
TPLPTATSSAPTLRAGGEPPIQEPAQGDLPHGSPCPSPNPSSAEPSGDSSGDESTPVAQL
PDWMAPGEQVWVGKRRGTVHYVGGVEFAKGIWIGVKLDMAVGKHNGTVQGRVYFRCPPGH
GVFVKPSRL
Download sequence
Identical sequences I3J4I3
ENSONIP00000003773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]