SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000003831 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000003831
Domain Number 1 Region: 39-156,215-284
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.36e-16
Family G proteins 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000003831   Gene: ENSONIG00000003060   Transcript: ENSONIT00000003832
Sequence length 492
Comment pep:known_by_projection scaffold:Orenil1.0:GL831173.1:1115754:1126230:-1 gene:ENSONIG00000003060 transcript:ENSONIT00000003832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVLEKQLPGAAGTGDNNNEEEEGQNLWSSILSEVSTRSSSKLPSGKNILIFGEDGSGK
TTLMAKLQGAEHNKKGRGLEYLYLSVHDEDRDDLTRCNVWILDGDLYHKGLLKFAVTAQS
LPDCLAIFVVDMSRPWTIMESLQKWASVLRDHVDKLKIPPENMREMEQKMIKAFQEYTEP
EDATPSSPQRRAPTAGEEEDVVLPLGENTLTHNLGIPVLIVCTKCDAVSVLEKEHDYRDE
HFDFIQSHIRRFCLHYGAGLIYTSVKEEKNLDLLYKYIVHKLYDFQFVTPALVVEKDAVF
IPSGWDNEKKIGILHENFTTVRPEDPFEDFITKPPVRKLVHDKEINAEDEQVFLMKQQSL
LAKQPATPTRGATESPGRTGSGSPRPGGRAVPTAVTSGSPMASVKKPDPNMKPGAANEGV
LANFFNSLLSKKTGSPGSPGAGAVGAGVQGSAKKTGQKPGLTDVQAELDRMTRKQDSMVS
ANNIPPQTENEA
Download sequence
Identical sequences I3J4P1
ENSONIP00000003831 ENSONIP00000003831 XP_003445753.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]