SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004108 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004108
Domain Number 1 Region: 59-84,207-382
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-51
Family G proteins 0.0000000834
Further Details:      
 
Domain Number 2 Region: 88-209
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 5.76e-33
Family Transducin (alpha subunit), insertion domain 0.00000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004108   Gene: ENSONIG00000003273   Transcript: ENSONIT00000004109
Sequence length 385
Comment pep:known_by_projection scaffold:Orenil1.0:GL831326.1:928721:954086:1 gene:ENSONIG00000003273 transcript:ENSONIT00000004109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVVRTLSRCLLPAEASRDPGGSKERSRERDAAQEREARRRSREIDAMIARERRAIRRL
VKILLLGAGESGKSTFLKQMRIINGQEFDQKALLDFRDTIYENILKGMRVLVDARDKLGI
SWQSCENEKQGMLVMSWEGRVGASGVEPSEFQLYVMALSALWADAGIQEAYTRRSEFQLS
ESVKYFLDNLDRIGQLNYIPSKQDILFARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQ
KWFQCFDGITSILFMASSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFLNVSIILFLN
KTDLLVEKIRTADIRKNFPEFRGDPRRLEDVQAFLVQLFSRKRRNRGKPLFHHFTTAVDT
ENIRFVFHAVKDTILQENLKDIMLQ
Download sequence
Identical sequences I3J5G8
ENSONIP00000004108 XP_003456001.1.78416 ENSONIP00000004108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]