SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004115 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000004115
Domain Number - Region: 243-264,296-414
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0173
Family PAPS sulfotransferase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004115   Gene: ENSONIG00000003280   Transcript: ENSONIT00000004116
Sequence length 421
Comment pep:known_by_projection scaffold:Orenil1.0:GL831326.1:978156:989782:-1 gene:ENSONIG00000003280 transcript:ENSONIT00000004116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTWRGLRVAFIMGSLFMILLIIVYWDDVGGFSLYPLKDPKHEVLQSGCCAPTTMSPPQT
TPASRAHTTSSSIVSATTSSTSFIPKEAAQEHTEEGEGKQKHAQRKEETREDAEMEIAAS
DREQEARKKRIDDVCSGKEDVEVPERTRPFSQIPNRELDHLIVDDTHQIIYCYVPKVACT
NWKRVMVVLSQSLISSSSGKPYTDPEAVPADLVHNSTLHLTFAKFWRRYGSLSRHLMALK
LQHYTKFLFVRDPFVRLISAFRNKFGRPNQDFYRQFGSVMLRRYGNVSGDLPETATEAFE
AGIKPTFQQFITYLLDPETEKESIFNEHWRQVYRLCHPCQVKYDFIGKLETLETDAEHLL
KLLKVDHLIRFPSGAQNKTAASWERDWFAQIPISTQKQLYKLYELDFELFGYPKPDSVLH
Q
Download sequence
Identical sequences I3J5H5
XP_013119997.1.78416 XP_019215662.1.78416 XP_019215663.1.78416 XP_019215664.1.78416 ENSONIP00000004115 ENSONIP00000004115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]