SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004139 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004139
Domain Number 1 Region: 507-763
Classification Level Classification E-value
Superfamily RNI-like 1.77e-51
Family 28-residue LRR 0.00021
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000004139
Domain Number - Region: 92-265
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000323
Family Nitrogenase iron protein-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004139   Gene: ENSONIG00000003297   Transcript: ENSONIT00000004140
Sequence length 777
Comment pep:novel scaffold:Orenil1.0:GL831133.1:10357577:10366713:-1 gene:ENSONIG00000003297 transcript:ENSONIT00000004140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYWDQCASSDVGLQEALDEHKISLRRRCECVTEGTDETGSRTLLSRSYTELFITEGQSEE
IQTQHEVMQLETASKMEGHDDTTVRCHDIFKVLPDQQRPIRVVLTNGVAGVGKTFSVQKF
TLDWAEGLENQHVSVVVLLSFRELNLIRDEQYSLLELLHVFHPTLQKVTAEKLAVCKLLF
IFDGLDESRLSLDFTNRKLLSDVTQKSSVSQLLTNLIQGNLLPSALVWITSRPAAANQIP
PTCVDRVTEVRGFTDAQKEEYFRHMKTSRSLHIMCSIPVFCWITATVLEHMLTTEQRGAL
PKTLTDMYSHFLLVQTKRKKNKYHEGRKTSLQEQTEADKEVLLKLGKLAFQHLEKGNILF
YQEHLEHCGLDVTEASVYSGVCTEIFKRECEIFKKAAYCFVHLSIQEFLAAVYLFYCFTH
RKTERDWEYKNSSPSMDVFLQRVMKKSLRSKNGHLDMFVRFLHGLSLESNQRLLGGLLGW
TENSPKNVEIVINNLNKMNSDEMSPDRSINIFHCLMEMKNLSVLQEIQEFLKSKNRSDKK
LSEIHCSALAYMLQMSEEVLDELDLRKYNASEKGQWRLIPAVRNCKKAGLCGCRLSETHC
EVVASALKSSPSHLTQLDLSYNDLQDSGVKHLSAALENPNCRLEHLRLRASSLSEMSCAF
LVSALKSNPSHLKHLDMSDNKLQDSGVKQLASLVKSSHCRLETLRLRGCELSETSCSYLG
SALKSSPSHLRHLDLGHNTLEDSGVKQLSNLMKSPHCLLETLRASSDLGGFLCITVG
Download sequence
Identical sequences I3J5J9
ENSONIP00000004139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]