SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004289 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004289
Domain Number 1 Region: 235-344
Classification Level Classification E-value
Superfamily Cytokine 1.49e-18
Family Interleukin-1 (IL-1) 0.01
Further Details:      
 
Domain Number 2 Region: 43-78
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000634
Family PDZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004289   Gene: ENSONIG00000003405   Transcript: ENSONIT00000004290
Sequence length 350
Comment pep:novel scaffold:Orenil1.0:GL831173.1:4424357:4433756:1 gene:ENSONIG00000003405 transcript:ENSONIT00000004290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKESLVKGGVLIAHKINEGKHQYVVENVVKYKNDNGGKLYVRKGDKLLQINGMDLNDL
TPEELANVIAEGSPMLTVCKPASEEDHTEETSLTEDTLHPVSKESTVLSFSWEMTREDDP
EGIEVEPQEEEKETGNIEEDLCQAKTEENEIFVVEMTKTSISLVRGRGCDATGCTLNDII
MVAESSTVTLVPRGGGTFRQEKLSNVLIENLATHQYLRGICSERIVYASPNPERITIYYY
KSSGLIRGSSGLPVVLNLTDSNCFLMCCKQADRVLLKVETCEKQRLKQISKSDESTLSFV
FYMKGDSARRRSFESALYRGWFINVCNTDTVGVATPDGRVDQSFLFIIQK
Download sequence
Identical sequences I3J5Z9
XP_003445852.1.78416 ENSONIP00000004289 ENSONIP00000004289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]