SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004336 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004336
Domain Number 1 Region: 17-110
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000895
Family Caspase recruitment domain, CARD 0.022
Further Details:      
 
Domain Number 2 Region: 584-664
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000546
Family PDZ domain 0.025
Further Details:      
 
Domain Number 3 Region: 864-998
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000195
Family Nucleotide and nucleoside kinases 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000004336
Domain Number - Region: 292-387
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0288
Family Mitotic arrest deficient-like 1, Mad1 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004336   Gene: ENSONIG00000003444   Transcript: ENSONIT00000004338
Sequence length 1002
Comment pep:known_by_projection scaffold:Orenil1.0:GL831194.1:1970015:1987244:1 gene:ENSONIG00000003444 transcript:ENSONIT00000004338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEECVPKDLDPKEMGEEELWELINDNRHRISLGVRPCILIPYLRQARVLNEMDEDEILS
CHNLTNRCMRTSHMLDLLRTQGKNGGMALLESLMIHYPALYTQVTGRKPSTEPSRFSGLI
KYSELTEYLVRAVTGMQKELQEARNEASKLRAHGASLEADISQMMEQEMKSRTLRTDNER
IQRHLCSLQREVTKLKDEKCDLYIRYTAAIEEKSAVNGRLHELNLQVYQLQTELQNAQAE
NEFQRQRSLKSVCPESPQLQDEVKSYLLFLLHQARQDILAQDLAEAIDSQVELAEQLRSY
REENEQLLRDKKKLLDQNESLSLQVQQLTLDCKMHQEKNTVIQSQMKALQAERDQAYQSR
DEAQAMIARVLAEKDTLRCQLVELQEKVFSLQTKRSSTELHQSSEETEGGWDSPSSSSDE
CPVSCRRRLCRMDAINPSMVSFMILCSVSVCAVYIDLCWKCEDGAMCSVRSRNAEPPSPE
SLRRRKEILYAESSSKRKTEEKCDRELKNANLFRSLRSSIEITNSEAAETDSLLDDFVLL
PSVVSLSRSSVPPFLMRSRPKAIRVSGRVLSISFQGEALLSQLAVVGGNKTGVFVHQVTE
GSAAHTVGISPGAQIVEVKYEKNQKALRMVLEDSTLEEAMWALGQVAGICHLSLRPRQDD
YEALLQQLQSSETSSGDSFYVRVNMSLAAGPGGTLAVSCNDILHVTNTRPAGIDDSWCAS
HVHPCQLLDLQSGTVPNYYRAQRLLIRAIEDMSFQAKKSEKGERVMTQNTQKTVRIVSTG
RQGRNPLWVSVEEEKSASAESDATSAPRSCVTLMPYTLVTPRYPPVCRPVLLLPSVLGRI
LDKKLASWQGFQLCEPEVLSSSEHAAQLQRSEILEEVEQGGSRCYTLQSVEKVMKKGIHC
VLPLGLDCVRRLQRSEIFPIIIFIGQSARSARKLRSKLHRHSQTEEQLLACSRSEEPLLD
KLPCLYHSVDPESWCDQTSLLTSLRTIIWEEQKKIVWVEPDL
Download sequence
Identical sequences I3J646
ENSONIP00000004336 ENSONIP00000004336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]