SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004410 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004410
Domain Number 1 Region: 12-265
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.96e-24
Family Tryptophan biosynthesis enzymes 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004410   Gene: ENSONIG00000003502   Transcript: ENSONIT00000004412
Sequence length 268
Comment pep:known_by_projection scaffold:Orenil1.0:GL831133.1:12227708:12235984:-1 gene:ENSONIG00000003502 transcript:ENSONIT00000004412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFLELFGRLKSVVIGMIHVKALPGSPLGSLKMSEISEAACREAAIYRDAGVDGLIVENM
HDVPYSLSVGPEVSACMTAVCCSVRAACPSLPIGAQILTAANQQALAVALASGLDFIRAE
GFVFAHVADEGLLNAGAGDLLRYRKQIGAEHVQIFTDIKKKHSSHALTSDVSVAETARAA
EFFLSDGIIITGAATGLQADPEELRDVSRSVGIPVLIGSGVTYDNVERYLDANAMIVGSH
FKLGGHWANEVDPQRVKRFMGKIRKLRQ
Download sequence
Identical sequences I3J6C0
ENSONIP00000004410 ENSONIP00000004410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]