SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004464 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004464
Domain Number 1 Region: 243-440,511-851
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.36e-73
Family Tandem AAA-ATPase domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004464   Gene: ENSONIG00000003546   Transcript: ENSONIT00000004466
Sequence length 1064
Comment pep:known_by_projection scaffold:Orenil1.0:GL831295.1:103271:128560:1 gene:ENSONIG00000003546 transcript:ENSONIT00000004466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYGYGGGGGRRGRRGGRGHRDGSRERWERGGGGGSRGNSSEFDPDRGGGGQRDRPPPHL
KGREIGLWYARYGAVRRKQADRRSRAVVQMDEAREQHITKLLNSVQNDQLGLERGCRDER
ASTSDSWQTAARDSAHCYFDGDLPEEEKTKTEVKWEEEEGSSGQKKAAGKSQSHSTTAVK
DEPPDKWDEEDQEEEVAKPVIKDKDLEFLHQEVVRDRSLDDYLKRDLQSKKSDAKYKEML
KFREKLPSYGKKEELVTLINSNRVLVVSGETGCGKTTQVTQFILDDYINRGMGSMCRVVC
TQPRRISAISVAERVAAERAESVGNGNSCGYQIRLQSRLPRRQGSILYCTTGIILQWLRS
DPLLSSISHLVLDEIHERNLQSDVLLIIVKDLLNLRDDLKIILMSATLNAEKFSQYFDNC
PMIHIPGLTFPVEEFLLEDIIEMTRYRPQNQDRRPSWKRGFWQGRNSRPEKEEKEAEYKE
SWPCYARTLQGRYSDTTIEALEILDRDEKIDLDLILALIRYIVLNEEEGAILVFLPGWDN
ISTLNDLLMAQQMFRSDRFVIIPLHSLMPTVNQTQVFKRPPPGVRKIVIATNIAETSITI
DDVVYVIDGGKIKETNFDTSNNISTMMAEWVSLANAKQRKGRAGRVCPGKCYHLYNGLRA
SLLDAYQLPEIMRTPLEELCLQIKILKLGSIGRFLEKALDRPTEQAVSLAIKNLTELNAL
DQRENLTALGFHLARLPVEPHIGKLILFGALLGCLDPVLTIAASLSFKDPFFIPLGKEKM
ADMRRKVLSKNSKSDHLTIVNAFQGWEDAKQRGGRYEREFCWDNFLSANTLQMLQNMKGQ
FAEHLMHAGFVSSKDPKDPKSNVNSGNEKLIKAVIVAGLYPKVAMIRPSHSKKRPGVKVY
TQADGKVCIHPKSVNAEETEFNYTWLIYHLKMRTSSIFLYDCTEVSPFSLLFFGGDITIQ
KDEDQETIAVDQWIVFRSPARIAHLVKSLKKELDSLLQDKICNPAPVDWQNRQSKDCAVI
TAIIDLITTQEKPTGSNRGYGRTWASAPRGEHVYFNDEDDDDDD
Download sequence
Identical sequences I3J6H4
XP_003454864.1.78416 ENSONIP00000004464 ENSONIP00000004464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]