SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004532 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004532
Domain Number 1 Region: 14-192
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.83e-51
Family G proteins 0.000000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004532   Gene: ENSONIG00000003604   Transcript: ENSONIT00000004534
Sequence length 200
Comment pep:known_by_projection scaffold:Orenil1.0:GL831292.1:616068:618406:-1 gene:ENSONIG00000003604 transcript:ENSONIT00000004534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGKNKNQSSLVLHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
DVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATSEFREQILRVKEEEAI
PLLLVGNKSDLEDRRQVSAEEATAKASEWGVQYVETSAKTRANVDKVFFDLMREVRKKKM
SESKDNGPSGKKKKKHCCVL
Download sequence
Identical sequences I3J6P2
XP_003454727.1.78416 ENSONIP00000004532 ENSONIP00000004532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]