SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004569 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004569
Domain Number 1 Region: 30-57,175-353
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-58
Family G proteins 0.00000018
Further Details:      
 
Domain Number 2 Region: 61-179
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.15e-35
Family Transducin (alpha subunit), insertion domain 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004569   Gene: ENSONIG00000003631   Transcript: ENSONIT00000004571
Sequence length 355
Comment pep:known_by_projection scaffold:Orenil1.0:GL831163.1:568621:582059:1 gene:ENSONIG00000003631 transcript:ENSONIT00000004571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGG
FNLEACKEYKPLILYNAIDSLTRIIRALSTLKIDFHNPDRAYDAVQLFALTGPAESKGEI
TPELLGVMKRLWADSGVQECFQRSNEYHLEDNTAYYLNDLDRISAPEYIPTVEDILRSRD
MTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQ
TSRMAESLRLFDSICNNNWFTNTSLILFLNKKDLLAEKIKRIPLTVCFPDYKGQNTYEEA
AVYVQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLKYIGLC
Download sequence
Identical sequences I3J6S9
ENSONIP00000004569 XP_004538254.1.88231 XP_005451368.1.78416 XP_005735362.1.53837 XP_005941867.1.24487 XP_006788856.1.46954 XP_019216674.1.78416 ENSONIP00000004569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]