SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004752 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004752
Domain Number 1 Region: 15-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.39e-70
Family Motor proteins 0.0000000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004752   Gene: ENSONIG00000003778   Transcript: ENSONIT00000004755
Sequence length 840
Comment pep:known_by_projection scaffold:Orenil1.0:GL831219.1:2745215:2761574:-1 gene:ENSONIG00000003778 transcript:ENSONIT00000004755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCRGSSSVRPVTETMIHSLLSFSSTVSKTNLPVHEDKNRVPYVKGCTERFVCTPEEVME
AIDEGKNNRSVAVTNMNEHSSRSHSIFLINIKQENSKTEQKLTGKLYLVDLAGSEKVGKT
GAEGTVLDEAKMINKSLSALGIVISALAEGSSYIPYRDSKMTRILQDSLGGNCRTTMVIC
CSPSAYNDAETRSTLLFGQRAKTIKNQVSMNVELTAEQWKSKWEKEKEKNKTLRNTVNWL
ENELNRWRSGESVPVDEQFDKEKAKEEVQALESTHHNDKTPPKPALNSLPGVKLTDAEKE
KYEAEMAKLYKELDDKDDEINQQSQLVETLKQQMLDQEELLASSRRDHDTLQTELNRLLA
ENEASKEEVKEVLQALEELAVNYDQKSQEVENKTKEFEALSEELNEKSSSLASIDSELQK
LKEMTNHQKKRVTEMMSSLLKDLAEIGIAVGSNDIKQQESSGLIDEEFTVARLYISKMKS
EVKTMVKRSKLLESTQTETTQKLDQTESELTACQLRISQQEAKIKSLTESLQNVEQKKRQ
LEENVDSLSEEIVRIRAQEKVNAMEKENEIQSANEVKEAVEKQIQTHREAHQKQISNLRD
ELDAKEKLITELQDLNQQIMLEQERLRVEHEKLKAADQEKSRQLEELTVQQDRREQARQD
LKGLEETVARELQTLHNLRRLFVQDLSTRLKKNAQMNSEDTESSAAQKQKISFLENNLEQ
LTRVHKQLVRDNNDLRSEIPKMEKRLRATAERVKALETALKEAKENAARDRKRYQQEVER
IKDAVKPKNMGRRGSAQIAKPIRPGQLPGAPINFSVNRSNLIQNNHPTGIKGGGGGNNSP
Download sequence
Identical sequences I3J7B2
ENSONIP00000004752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]