SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004754 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004754
Domain Number 1 Region: 8-251
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.6e-41
Family Nitrogenase iron protein-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004754   Gene: ENSONIG00000003779   Transcript: ENSONIT00000004757
Sequence length 285
Comment pep:known_by_projection scaffold:Orenil1.0:GL831163.1:1715054:1718061:1 gene:ENSONIG00000003779 transcript:ENSONIT00000004757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRYAQLVMGPAGSGKSTYCSTMVQHSETLNRSVQVVNLDPAAEHFDYPVMADIRELIQV
DDVMEDDSLRFGPNGGLVFCMEYFANNFDWLEESLGHVEDDYILFDCPGQIELYTHLPVM
KQLVEQLQQWEFRVCGVFLVDSQFMVESFKFISGVMAALSAMVSLEIPQVNIMTKMDLLS
PKAKKEIEKYLDPDMYSMMEDGSNTIRSKKFKKLTKAICGLIDDYSIVRFLPFDRTDEEG
INIVLQHIDFSIQYGEDLEFKEPKEVEEEPANLNYDEIFQDKVNS
Download sequence
Identical sequences I3J7B4
ENSONIP00000004754 XP_003444386.1.78416 ENSONIP00000004754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]