SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004777 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004777
Domain Number 1 Region: 228-438
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.67e-41
Family Decarboxylase 0.00000136
Further Details:      
 
Domain Number 2 Region: 4-200
Classification Level Classification E-value
Superfamily PRTase-like 1.01e-37
Family Phosphoribosyltransferases (PRTases) 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004777   Gene: ENSONIG00000003799   Transcript: ENSONIT00000004780
Sequence length 443
Comment pep:known_by_projection scaffold:Orenil1.0:GL832192.1:11733:15498:1 gene:ENSONIG00000003799 transcript:ENSONIT00000004780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGRRFTASLILKLHDVNGVKFGEYKLKSGLLAPIIDLRVLVSHPTLMNQVVSLIYERVQE
EGLQFHSVCGAPYTALPLATVICSQHELPMVIRRKEAKDYGTKRLVEGSFRQGDTCLIIE
DTVTSGTSILETAEVLCKEGLKVTDAVVLMDREQGGVEMLASKGIKLHPIISISQLLRVL
QAAERIDAQTAQSVHRFIQDNNRVFLPVGLNPKNGSDSPASKKLELRYSDRAELPNIHPL
ASKLLKIMEEKQSNLCVSADVTNSEELLQESLDPKICMLKTHVDVLEDYTSAFIQKVQAL
AEKHNFLIFEDRKFADIRNTVKHQYEGGLYQISSWSHIVNAHAVPGPGVLKGLSAAGKPL
GRGCLLVAQMSSGSLAAGEYTKAAVQMAEEHSDFVMGFICGSKLTERPEFIHMTPGVQMQ
AGGDLLGQQYTTPEEVVQDKDNN
Download sequence
Identical sequences I3J7D7
ENSONIP00000004777 ENSONIP00000004777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]