SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000004818 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000004818
Domain Number 1 Region: 346-468
Classification Level Classification E-value
Superfamily Bromodomain 5.1e-43
Family Bromodomain 0.00025
Further Details:      
 
Domain Number 2 Region: 28-161
Classification Level Classification E-value
Superfamily Bromodomain 1.44e-42
Family Bromodomain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000004818   Gene: ENSONIG00000003825   Transcript: ENSONIT00000004821
Sequence length 1301
Comment pep:known_by_projection scaffold:Orenil1.0:GL831359.1:424160:438976:1 gene:ENSONIG00000003825 transcript:ENSONIT00000004821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSAQPLQPTSAMGDGLEAGSSHNPPSAPPPIPFNPPPPETWNPSRPKRQTNQLQYLQKVV
LKTLWKHNFAWPFQAPVDAIKLNLPDYYKIIKSPMDMGTIKKRLENNYYWNAQECIQDFN
TMFTNCYIYNKPGDDIVLMAEALEKLFLQKITEMPQEETEIAVVTKGRRGGRQDTVVQPL
VQPLVQPLVQPLVQPLAQPLAQPLAQTLAQPLVQTLAQTLAQPQLPRVPPTPTNHAPHLG
PPFSLSASDVLAQGMTSVPPPTVTHPGLHPTVPILQSSPALIKQKKSQKRKADTTTPTAN
DQLSESSPVSAETRPRRDSSRPSKQPKREASQPDSQHHLGGGLEMGESGTPKRQEQLRWC
ARLVREMLSKKHVAYAWPFYKPVDAKALGLHDYHEIIKHPMDLSTIKKKLDNRQYRDAQE
FAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEMRFAKMPDDPEEPVPVPTPSSALHPA
PSTRQVPPPSAASEDESSSSSESESSGGDSEQERKQRLAELQEQLKAVHEQLAALSQPQV
SKPKKKEREKKEKKKEKHKKKVGAEEPASKKSKSSKEPISAKKDRKKPSKKEGVKNPRPA
VPPQPGPTPLVPSASLEDVDIDMSADRCKPMSYEEKRQLSLDINKLPGDKLGRVVHIIQT
REPSLKNSNPDEIEIDFETLKPSTLRELEKYVSSCLRKKKKPSAEKPLEIPNVTKMKTGS
SSSGSSESSDSEDSDSGLVPKQPKKTSTNKDTKRPQHQSTGSGVGPVTSQPQSQFQSQLQ
SQLQPQLQLQLQLQPQLQPQTQPQVVQSKPPYIPPPATNQTPSETHPFLNQHPIIPSPAI
HNALPQQPSRPSNRAAPLPPKPAQPPPSSLPPVPRPRVPSPPSHGILGTLSAQPPQALLE
DDEEPTPTSSETPPLSQVHSLLQSLQPRATTQTLHTHSPVQLGPPLHAQVMTTATPVLTQ
RHSSGQVHMQQSFPHTHTSTPQQQQKGGVLQQKVQQLQQHQQQPSPQSKVEPFTTGCPSP
LMMHSPPMPAFHSMGQQSPPQTKKHEQRSNMGIKEEKLSQSPVLPPSPFSPGVRQDVHKP
DNKHSECKRLDIKPMDGSRPISHLADSPAPPCSQQDNKIKQEPKTPIAPKKAQDVKIKNM
GSWASLAQKSQSTPAFSVRSSSDSFERYKQVAREKEERERQLKAQAEQARREQEKLRRSR
DDKDTAEPFRRVPDDDRRRPNQQSPHAPVPPASTPPTHSPQAPPTQSQAPPPTSASQNTL
NQDRATARREAQERRRREAMADTIDINFQSDLMAIFEENLF
Download sequence
Identical sequences I3J7H8
ENSONIP00000004818 ENSONIP00000004818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]